PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S05652.50 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 115aa MW: 12986 Da PI: 9.0086 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 131 | 5e-41 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 +CaaCk+lrr+C+ dC+++pyfp+++p++fa+vhk++Gasnv k+l+++p++ r a++sl+yeA+ r++dPvyG+vg+i+ l+qq++ ++++la+ Jcr4S05652.50 5 RCAACKYLRRRCSLDCIFSPYFPSNNPQRFAYVHKIYGASNVAKILQQVPDHLRASAAESLYYEAKYRIEDPVYGCVGIISLLHQQIHIAENQLAK 100 6*********************************************************************************************** PP DUF260 97 lkee 100 +k+e Jcr4S05652.50 101 TKAE 104 9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.594 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.1E-40 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MSCGRCAACK YLRRRCSLDC IFSPYFPSNN PQRFAYVHKI YGASNVAKIL QQVPDHLRAS 60 AAESLYYEAK YRIEDPVYGC VGIISLLHQQ IHIAENQLAK TKAEIAVLAS QNFTK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012087781.1 | 3e-81 | LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 8e-52 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | B9SXJ8 | 1e-61 | B9SXJ8_RICCO; LOB domain-containing protein, putative | ||||
STRING | XP_002530717.1 | 2e-62 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 3e-54 | LOB domain-containing protein 24 |