PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S05571.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | ARF | ||||||||
Protein Properties | Length: 148aa MW: 16709.5 Da PI: 10.4917 | ||||||||
Description | ARF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 35.6 | 1.6e-11 | 18 | 61 | 54 | 99 |
EETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 54 kksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 ++++r++lt+GW+ Fv+a++L +gD+v+F ++++ +l+++++r+ Jcr4S05571.20 18 GQPKRHLLTTGWSVFVSAKRLVAGDSVLFI--WNEKNQLLLGIRRA 61 67899*************************..8899999****997 PP | |||||||
2 | Auxin_resp | 80.7 | 3.3e-27 | 86 | 147 | 1 | 61 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsG 61 aahaa+t+s F+v+YnPras+seFv++++k++ka+ ++vsvGmRf+m fete+ss rr++G Jcr4S05571.20 86 AAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFhTRVSVGMRFRMLFETEESSVRRYYG 147 79********************************87599*********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.474 | 1 | 62 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.24E-14 | 16 | 89 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 2.5E-16 | 18 | 75 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 4.1E-9 | 18 | 61 | IPR003340 | B3 DNA binding domain |
Pfam | PF06507 | 2.3E-22 | 86 | 147 | IPR010525 | Auxin response factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009725 | Biological Process | response to hormone | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MFYIILIHLP QIYLDLIGQP KRHLLTTGWS VFVSAKRLVA GDSVLFIWNE KNQLLLGIRR 60 ATRPQTVMPS SVLSSDSMHI GLLAAAAHAA ATNSCFTVFY NPRASPSEFV IPLSKYVKAV 120 FHTRVSVGMR FRMLFETEES SVRRYYGS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldu_A | 2e-55 | 18 | 148 | 216 | 346 | Auxin response factor 5 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021592753.1 | 2e-84 | auxin response factor 8-like isoform X4 | ||||
Refseq | XP_021603559.1 | 5e-84 | auxin response factor 8-like isoform X2 | ||||
Refseq | XP_021603560.1 | 2e-84 | auxin response factor 8-like isoform X3 | ||||
Refseq | XP_021647232.1 | 9e-85 | auxin response factor 8-like isoform X2 | ||||
Swissprot | Q0J951 | 3e-75 | ARFL_ORYSJ; Auxin response factor 12 | ||||
Swissprot | Q258Y5 | 3e-75 | ARFL_ORYSI; Auxin response factor 12 | ||||
TrEMBL | A0A067KWZ2 | 2e-82 | A0A067KWZ2_JATCU; Auxin response factor | ||||
TrEMBL | A0A2C9WEB5 | 4e-83 | A0A2C9WEB5_MANES; Auxin response factor | ||||
TrEMBL | A0A2C9WK86 | 4e-83 | A0A2C9WK86_MANES; Auxin response factor | ||||
STRING | cassava4.1_001769m | 4e-83 | (Manihot esculenta) | ||||
STRING | cassava4.1_001923m | 3e-83 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF19164 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30330.1 | 1e-74 | auxin response factor 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|