PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05032.10
Common NameJCGZ_01318, LOC105646557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family WOX
Protein Properties Length: 190aa    MW: 21747.2 Da    PI: 9.4578
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05032.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.29e-213697157
                   TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   ++ R+++t+eq+++L +lF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Jcr4S05032.10 36 KCGRWNPTSEQVKVLTDLFRSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 97
                   568*****************99**************************************97 PP

2Wus_type_Homeobox1147.5e-373699265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
      Jcr4S05032.10 36 KCGRWNPTSEQVKVLTDLFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 99
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.0133398IPR001356Homeobox domain
SMARTSM003892.9E-435102IPR001356Homeobox domain
PfamPF000465.8E-183797IPR001356Homeobox domain
SuperFamilySSF466898.55E-1238100IPR009057Homeodomain-like
CDDcd000862.12E-43999No hitNo description
Gene3DG3DSA:1.10.10.601.8E-83997IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEDRMSMSGF CFTNKVRGGG GRGGGGSGNN CSTGTKCGRW NPTSEQVKVL TDLFRSGLRT  60
PSTDQIQKIS SQLSFYGKIE SKNVFYWFQN HKARERQKRR RVSVDENKDT IRREDNPSSS  120
ARYFTEISQV TEPERVLETL QLFPLNSFSE GQPEKLRFQG NDQYKEPTSF SYTFGTEMDH  180
PPLDLRLSFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11925GGRGGGG
297101KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:25631790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087815.11e-140WUSCHEL-related homeobox 7
SwissprotQ8H1D23e-65WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A067LC761e-138A0A067LC76_JATCU; Uncharacterized protein
STRINGcassava4.1_017042m3e-98(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.12e-63WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Conte MG,Gaillard S,Droc G,Perin C
    Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants.
    BMC Genomics, 2008. 9: p. 183
    [PMID:18426584]
  2. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  3. Tian H,Niu T,Yu Q,Quan T,Ding Z
    Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis.
    Plant Signal Behav, 2013. 8(12): p. e26429
    [PMID:24056047]
  4. Tian H,Jia Y,Niu T,Yu Q,Ding Z
    The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
    Plant Cell Rep., 2014. 33(5): p. 745-53
    [PMID:24504658]
  5. Reyes-Hernández BJ, et al.
    The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana.
    New Phytol., 2014. 202(4): p. 1223-36
    [PMID:24635769]
  6. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]
  7. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  8. Ji H, et al.
    PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis.
    Plant J., 2015. 81(3): p. 399-412
    [PMID:25438658]
  9. Su YH,Liu YB,Bai B,Zhang XS
    Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis.
    Front Plant Sci, 2014. 5: p. 792
    [PMID:25642237]
  10. Jia Y, et al.
    The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
    J. Exp. Bot., 2015. 66(15): p. 4631-42
    [PMID:25998905]
  11. Zhang M, et al.
    A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
    Plant J., 2015. 83(4): p. 582-99
    [PMID:26072661]
  12. Kong X,Lu S,Tian H,Ding Z
    WOX5 is Shining in the Root Stem Cell Niche.
    Trends Plant Sci., 2015. 20(10): p. 601-603
    [PMID:26440429]
  13. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  14. Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX
    Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution.
    Mol. Biol. Evol., 2017. 34(3): p. 640-653
    [PMID:28053005]
  15. Singh S, et al.
    Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components.
    Sci Rep, 2017. 7: p. 42450
    [PMID:28195159]
  16. García-Gómez ML,Azpeitia E,Álvarez-Buylla ER
    A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana.
    PLoS Comput. Biol., 2017. 13(4): p. e1005488
    [PMID:28426669]
  17. Long Y, et al.
    In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
    Nature, 2017. 548(7665): p. 97-102
    [PMID:28746306]
  18. Bruno L, et al.
    In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk.
    Front Plant Sci, 2017. 8: p. 1323
    [PMID:28798767]
  19. Hu B, et al.
    Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms.
    Regeneration (Oxf), 2017. 4(3): p. 132-139
    [PMID:28975033]
  20. Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI
    Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration.
    J. Cell. Sci., 2019.
    [PMID:29242230]
  21. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  22. Dolzblasz A, et al.
    Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4.
    Int J Mol Sci, 2018.
    [PMID:29538317]