PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S04574.20 | ||||||||
Common Name | JCGZ_14330, LOC105642924, WRKY21 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 195aa MW: 21755.6 Da PI: 9.4207 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.5 | 1.1e-32 | 116 | 174 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ Jcr4S04574.20 116 LDDGYRWRKYGQKAVKNSTHPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 174 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.0E-33 | 102 | 174 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-28 | 109 | 175 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.988 | 111 | 176 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.8E-38 | 116 | 175 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.0E-26 | 117 | 174 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MEGQEAPSPP SPSYLFMPAP SSLPSSALNP GAAPFLEGHV LPAPDIDWVS LLSAAQSENG 60 LMSMEGGSVV NIGEEGKGNI GNNNNNNNEK RKICSRVKKH TRPRFAFQTR SADDILDDGY 120 RWRKYGQKAV KNSTHPRSYY RCTHHTCNVK KQVQRLSKDT SIVVTTYEGI HNHPCEKLME 180 TLTPILKQMQ FLARF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-24 | 106 | 173 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-24 | 106 | 173 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00317 | DAP | Transfer from AT2G46130 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC485273 | 0.0 | KC485273.1 Jatropha curcas WRKY transcription factor 21 (WRKY21) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012083303.1 | 1e-147 | probable WRKY transcription factor 43 | ||||
Swissprot | Q8GY11 | 2e-55 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
TrEMBL | S5CH38 | 1e-146 | S5CH38_JATCU; WRKY transcription factor 21 | ||||
STRING | XP_006491470.1 | 4e-83 | (Citrus sinensis) | ||||
STRING | XP_006444939.1 | 4e-83 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46130.1 | 4e-57 | WRKY DNA-binding protein 43 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105642924 |
Publications ? help Back to Top | |||
---|---|---|---|
|