PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S03172.20
Organism
Jatropha curcas
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 61aa    MW: 7332.81 Da    PI: 10.6332
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S03172.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA56.49.6e-18946139
      CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpyl 39
                   +ep+YVNaKQy++Il+RR +Rak+e ekkl +k rk y+
  Jcr4S03172.20  9 EEPVYVNAKQYHGILRRRRSRAKAELEKKL-IKVRKVYI 46
                   69****************************.*****997 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.6E-9758IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.093861IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-131046IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601333IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MVLPLEMTEE PVYVNAKQYH GILRRRRSRA KAELEKKLIK VRKVYICACP SIFKFSNFRL  60
Y
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086116.11e-22nuclear transcription factor Y subunit A-10 isoform X1
RefseqXP_012086117.11e-22nuclear transcription factor Y subunit A-10 isoform X1
SwissprotQ9LXV55e-17NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A067K2I83e-21A0A067K2I8_JATCU; Uncharacterized protein
STRINGcassava4.1_012382m1e-21(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.42e-19nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]