PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S02612.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 172aa MW: 20147.8 Da PI: 9.6771 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.7 | 2.3e-09 | 115 | 149 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp++ ++ LA+ +gL+++q+ +WF N+R ++ Jcr4S02612.10 115 KWPYPTEGDKIALAEATGLDQKQINNWFINQRKRH 149 569*****************************985 PP | |||||||
2 | ELK | 38.3 | 2.8e-13 | 69 | 90 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKYsgy+++Lk+EFs Jcr4S02612.10 69 ELKDKLLRKYSGYISNLKHEFS 90 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 1.1E-7 | 69 | 90 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.86 | 69 | 89 | IPR005539 | ELK domain |
Pfam | PF03789 | 4.2E-11 | 69 | 90 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.487 | 89 | 152 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.14E-20 | 90 | 166 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.9E-13 | 91 | 156 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-28 | 94 | 153 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.18E-11 | 101 | 153 | No hit | No description |
Pfam | PF05920 | 2.0E-17 | 109 | 148 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 127 | 150 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MRGHNRHFKI GKQSCKPQGA PRSYRCWAEP VSATIRLNDE AAGSSDEDVS GGEVEIEMQD 60 CLRPNEDREL KDKLLRKYSG YISNLKHEFS KKKKKGKLPK EARQVLLNWW NIHYKWPYPT 120 EGDKIALAEA TGLDQKQINN WFINQRKRHW KPSENMQFSV VDSIYGSYFM NE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012080031.1 | 1e-87 | homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 2e-56 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A067KGV6 | 1e-86 | A0A067KGV6_JATCU; Uncharacterized protein | ||||
STRING | cassava4.1_011625m | 2e-73 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-52 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|