PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S02283.60 | ||||||||
Common Name | JCGZ_23220 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 158aa MW: 18159.3 Da PI: 6.5477 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.6 | 2.3e-09 | 88 | 121 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp+++e+ +L++ +gL+++q+ +WF N+R ++ Jcr4S02283.60 88 WPYPTEDEKVKLSEITGLDQKQINNWFINQRKRH 121 59*****************************885 PP | |||||||
2 | ELK | 36 | 1.5e-12 | 43 | 62 | 3 | 22 |
ELK 3 KhqLlrKYsgyLgsLkqEFs 22 K +L+rKYsgyL++L++EF+ Jcr4S02283.60 43 KGMLMRKYSGYLSNLRKEFL 62 99*****************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 8.3E-6 | 41 | 62 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.371 | 41 | 61 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.2E-9 | 43 | 62 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.244 | 61 | 124 | IPR001356 | Homeobox domain |
SMART | SM00389 | 4.0E-13 | 63 | 128 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.52E-20 | 63 | 135 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.2E-28 | 66 | 126 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.44E-12 | 73 | 125 | No hit | No description |
Pfam | PF05920 | 5.2E-17 | 81 | 120 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 99 | 122 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MENINLFTDE AAGTSEEELS CGEIEASESQ ESSGGRPNDQ DVKGMLMRKY SGYLSNLRKE 60 FLKKRKKGKL PKDARTILLD WWNNHYRWPY PTEDEKVKLS EITGLDQKQI NNWFINQRKR 120 HWKPSEDMRF ALMEGVSVSS SMIGGPSYFD TGGRVSGD |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 56 | 65 | LRKEFLKKRK |
2 | 62 | 66 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012089429.1 | 1e-108 | homeobox protein knotted-1-like 1 | ||||
Swissprot | A2Y007 | 6e-55 | KNOSA_ORYSI; Homeobox protein knotted-1-like 10 | ||||
Swissprot | Q7GDL5 | 6e-55 | KNOSA_ORYSJ; Homeobox protein knotted-1-like 10 | ||||
TrEMBL | A0A067JHP6 | 1e-114 | A0A067JHP6_JATCU; Uncharacterized protein | ||||
STRING | cassava4.1_023097m | 4e-87 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 2e-36 | KNOTTED-like from Arabidopsis thaliana |