PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S01615.30

Common Name

JCGZ_24032, LOC105647380

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

CAMTA

Protein Properties

Length: 122aa MW: 14649.7 Da PI: 9.404

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S01615.30	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	161.8	1.3e-50	20	122	2	104
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 ++ ++rwl++ ei++iL n++k++++ e+++ p+sgsl+L++rk++ryfrkDG +w+kkkdgktv+E+he+LK g+v+vl+cyYah+e+n++fqrr Jcr4S01615.30 20 VEAQHRWLRPAEICEILRNYNKFRIAPEPPNMPTSGSLFLFDRKVLRYFRKDGLNWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNENFQRR 115 6779****************************************************************************************** PP CG-1 98 cywlLee 104 +yw+Lee Jcr4S01615.30 116 SYWMLEE 122 ***85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	72.093	15	122	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	3.7E-58	18	122	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.7E-43	21	121	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MAEGRRYPLG NHLDIEQILV EAQHRWLRPA EICEILRNYN KFRIAPEPPN MPTSGSLFLF 60 DRKVLRYFRK DGLNWRKKKD GKTVKEAHER LKSGSVDVLH CYYAHGEDNE NFQRRSYWML 120 EE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:18298954, ECO:0000269\|PubMed:19122675, ECO:0000269\|PubMed:19270186, ECO:0000269\|PubMed:21900483, ECO:0000269\|PubMed:22345509, ECO:0000269\|PubMed:22371088, ECO:0000269\|PubMed:23072934, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25157030, ECO:0000269\|PubMed:28351986, ECO:0000269\|PubMed:28407487, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269\|PubMed:11162426, ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:22345509}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM434540	4e-31	AM434540.2 Vitis vinifera contig VV78X210461.8, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012088869.1	3e-82	calmodulin-binding transcription activator 3 isoform X1
Refseq	XP_020541148.1	2e-82	calmodulin-binding transcription activator 3 isoform X2
Swissprot	Q8GSA7	6e-64	CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBL	A0A067LHJ4	7e-81	A0A067LHJ4_JATCU; Uncharacterized protein
STRING	XP_002531267.1	8e-80	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF14241	18	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22300.2	3e-66	signal responsive 1

Link Out ? help Back to Top
Entrez Gene	105647380

Publications ? help Back to Top
Zhang L,Du L,Shen C,Yang Y,Poovaiah BW Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling. Plant J., 2014. 78(2): p. 269-81 [PMID:24528504] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae. Front Plant Sci, 2016. 7: p. 177 [PMID:26973658] Benn G, et al. Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60 [PMID:27432993] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986] Lolle S, et al. Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles. Cell Host Microbe, 2017. 21(4): p. 518-529.e4 [PMID:28407487] Kim YS, et al. CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection. Plant Cell, 2017. 29(10): p. 2465-2477 [PMID:28982964] Jacob F, et al. A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana. New Phytol., 2018. 217(4): p. 1667-1680 [PMID:29226970]