PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00993.30

Common Name

JCGZ_06963, LOC105634537

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

M-type_MADS

Protein Properties

Length: 219aa MW: 24926.3 Da PI: 10.0675

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00993.30	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	68.8	5.1e-22	17	61	5	49
SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KKA+EL++LC++e+++i+fs+ k++ + Jcr4S00993.30 17 NESNLQVTFSKRRSGLFKKASELCTLCGVEISIIVFSPGKKVFSF 61 89************************************9999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	23.38	5	65	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.6E-29	5	64	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.67E-32	6	73	No hit	No description
SuperFamily	SSF55455	3.4E-26	6	79	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.8E-18	7	27	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-23	16	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.8E-18	27	42	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.8E-18	42	63	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009960	Biological Process	endosperm development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 219 aa Download sequence Send to blast
MSTKRGRQKV EMVKMPNESN LQVTFSKRRS GLFKKASELC TLCGVEISII VFSPGKKVFS 60 FGHPSVETVI ERFIARNPPQ SSPTLQLIQA HRNASVRELN VQLTQVLNQL DFEKKKGEEL 120 SQNRNDNKKE YWWEGPIEEL DFTQLKQLKM SLEELKKNVA KQADKVLVQN SHAQQFFASS 180 TSGAGIAPFE SKNGLFNPDM MHNNNNNNGY NHAYGRGFY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_B	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_I	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_J	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_A	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_B	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_C	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_D	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_I	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_J	3e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
5f28_A	4e-16	6	84	2	80	MEF2C
5f28_B	4e-16	6	84	2	80	MEF2C
5f28_C	4e-16	6	84	2	80	MEF2C
5f28_D	4e-16	6	84	2	80	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012072793.1	1e-163	agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	2e-63	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A067KZE0	1e-162	A0A067KZE0_JATCU; Uncharacterized protein
STRING	cassava4.1_031625m	1e-112	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF128	33	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	4e-58	AGAMOUS-like 62

Link Out ? help Back to Top
Entrez Gene	105634537

Publications ? help Back to Top
Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]