PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00911.40 | ||||||||
Common Name | JCGZ_26427, LOC105648777, WRKY19 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 163aa MW: 18901.9 Da PI: 8.7658 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.7 | 5.1e-33 | 73 | 131 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+++r+++d+++v++tYeg H+h+ Jcr4S00911.40 73 LDDGYRWRKYGQKTVKNSKFPRSYYKCTQNGCNVKKQIQRNTNDEEIVVTTYEGIHTHP 131 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.0E-33 | 59 | 131 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.28E-29 | 65 | 132 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.953 | 68 | 133 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.3E-37 | 73 | 132 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.3E-27 | 74 | 131 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MANLRIHFSD NENEESEITK HLDSNPINNN ICNIESGSSS RKSDNHIKAK TGKEKEITKH 60 RYAFQTRSQV DILDDGYRWR KYGQKTVKNS KFPRSYYKCT QNGCNVKKQI QRNTNDEEIV 120 VTTYEGIHTH PTQISTDNFE DIIIKQMQSY TFLSNAQSSA YAL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-28 | 63 | 130 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-28 | 63 | 130 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC485271 | 1e-156 | KC485271.1 Jatropha curcas WRKY transcription factor 19 (WRKY19) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012090665.1 | 1e-119 | probable WRKY transcription factor 75 isoform X1 | ||||
Swissprot | Q9FYA2 | 2e-47 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | S5CS52 | 1e-118 | S5CS52_JATCU; WRKY transcription factor 19 | ||||
STRING | XP_002511154.1 | 6e-60 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 9e-50 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105648777 |