 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Jcr4S00846.10 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
| Family |
CAMTA |
| Protein Properties |
Length: 60aa MW: 7058.04 Da PI: 6.7882 |
| Description |
CAMTA family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Jcr4S00846.10 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | CG-1 | 27.2 | 6.6e-09 | 21 | 54 | 3 | 36 |
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpks 36
+ ++rwl++ ei++iL n++k+++++e+++rp+s
Jcr4S00846.10 21 EAQHRWLRPAEICEILRNYQKFHIESEPPNRPPS 54
459*****************************87 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. |
| Best hit in Arabidopsis thaliana ? help
Back to Top |
| Hit ID |
E-value |
Description |
| AT5G64220.2 | 3e-30 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |
