PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00712.130

Common Name

JCGZ_17986

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

M-type_MADS

Protein Properties

Length: 94aa MW: 10439.1 Da PI: 9.4067

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00712.130	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	81.7	4.9e-26	2	52	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ s r+vtfskRrng++KKA EL +LCd+e+ vi+fs+ g+lye++s Jcr4S00712.130 2 KRIEDRSSRHVTFSKRRNGLIKKARELPILCDVEIGVIVFSTGGRLYEFCS 52 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	1.57E-23	1	55	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.7E-26	1	53	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	25.819	1	54	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.2E-25	3	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-15	16	31	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-15	31	52	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MKRIEDRSSR HVTFSKRRNG LIKKARELPI LCDVEIGVIV FSTGGRLYEF CSSGRSEKAC 60 AVGYSVFFFV IDLLSAARAL DASLDFASKN TVIC

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020539042.1	3e-59	agamous-like MADS-box protein AGL13 isoform X1
Swissprot	A2RVQ5	3e-20	AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBL	A0A067JVK4	9e-61	A0A067JVK4_JATCU; Uncharacterized protein
STRING	EOX99786	1e-20	(Theobroma cacao)
STRING	POPTR_0001s13660.1	4e-21	(Populus trichocarpa)
STRING	XP_009790268.1	1e-20	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	1e-22	AGAMOUS-like 16

Publications ? help Back to Top
Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971]