PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00587.60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 202aa MW: 23423.5 Da PI: 10.3045 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.7 | 1.9e-16 | 25 | 70 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd +l ++++ Ggg+W++I++ g++R++k+c++rw++yl Jcr4S00587.60 25 FWTKEEDRILMEYIRVNGGGRWNRISQLTGLRRCGKSCRLRWLNYL 70 6*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.7 | 2.3e-17 | 79 | 120 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++eEd+l+++++++lG++ W++Ia +++ gRt++q+k++w+ + Jcr4S00587.60 79 FSQEEDDLIIRLHNLLGNR-WSLIAGRLP-GRTANQVKNHWNCH 120 89*****************.*********.***********977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.339 | 18 | 70 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.2E-30 | 21 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-12 | 22 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 26 | 77 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-14 | 26 | 70 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.21E-10 | 26 | 70 | No hit | No description |
PROSITE profile | PS51294 | 24.688 | 71 | 125 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-16 | 75 | 123 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-24 | 78 | 125 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.6E-15 | 79 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.59E-12 | 79 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
PYYSVAKAVK ERKMKAEKDQ FKKRFWTKEE DRILMEYIRV NGGGRWNRIS QLTGLRRCGK 60 SCRLRWLNYL SPNVNHADFS QEEDDLIIRL HNLLGNRWSL IAGRLPGRTA NQVKNHWNCH 120 LRKRLGLKKQ ARKPVIRSSS KTEIQEINNS GQFLQNGKAI INNEDPFGVG TDSSNGGEAQ 180 LQVDDLSLFY NDDDFFNLNS QI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-26 | 20 | 125 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU937787 | 0.0 | GU937787.1 Jatropha curcas R2R3-type MYB transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001292932.1 | 1e-138 | uncharacterized protein LOC105644592 | ||||
Swissprot | Q96276 | 3e-54 | MYB23_ARATH; Transcription factor MYB23 | ||||
Swissprot | Q9SEI0 | 2e-54 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A067K2V4 | 1e-137 | A0A067K2V4_JATCU; MYB family protein | ||||
STRING | XP_006483851.1 | 1e-63 | (Citrus sinensis) | ||||
STRING | XP_006438388.1 | 1e-63 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 7e-57 | myb domain protein 66 |