PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00544.40
Common NameJCGZ_25192, LOC105629124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family bZIP
Protein Properties Length: 237aa    MW: 25442.5 Da    PI: 7.3243
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00544.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.1e-10189236552
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                    kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  ++ +l
  Jcr4S00544.40 189 KRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTML 236
                    9****************************************9887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-5185237IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.369187237IPR004827Basic-leucine zipper domain
PfamPF001703.8E-9189234IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-10189237No hitNo description
SuperFamilySSF579594.15E-10189237No hitNo description
CDDcd147036.49E-23190237No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDPSKFIGKQ PMTMDIEQMP DIPQRGSHHR RAHSDTSFRF DDLLLFDPSD LDLSSLDLPT  60
PTPPRSGSGV PMAVDSGSVS DDSASVSHSG PSTKPKPINH LRSLSVDSDF FDGLGLSSGG  120
GDEKFGGKAV ATAAAGAGGG TGERRVHHRH SNSMDGSTSS FEIESLMIDG VKKAMGPDRL  180
AELALIDPKR AKRILANRQS AARSKERKIR YTSELERKVQ TLQTEATTLS AQVTMLQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9911910.0KC991191.1 Vernicia fordii clone VF15450 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066035.21e-166DEAD-box ATP-dependent RNA helicase 8
SwissprotQ9MA756e-65VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A067L3F81e-169A0A067L3F8_JATCU; Uncharacterized protein
STRINGXP_002535507.11e-118(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52143450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.13e-40VIRE2-interacting protein 1
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]
  2. Wang Y, et al.
    The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus.
    New Phytol., 2014. 203(4): p. 1266-81
    [PMID:24865527]
  3. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  4. Chen J, et al.
    ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters.
    J. Exp. Bot., 2016. 67(5): p. 1327-38
    [PMID:26689855]
  5. Tsugama D,Liu S,Takano T
    VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis.
    Plant Signal Behav, 2016. 11(6): p. e1187358
    [PMID:27171129]
  6. Tsugama D,Liu S,Takano T
    The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots.
    Plant Physiol., 2016. 171(2): p. 1355-65
    [PMID:27208231]
  7. Takeo K,Ito T
    Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins.
    FEBS Lett., 2017. 591(13): p. 1972-1981
    [PMID:28542772]
  8. Wang L,Lacroix B,Guo J,Citovsky V
    The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family.
    Mol. Plant Pathol., 2018. 19(5): p. 1172-1183
    [PMID:28802023]