PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc010104.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB_related
Protein Properties Length: 38aa    MW: 4379.27 Da    PI: 10.689
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc010104.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.41.9e-09837231
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
          Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartm 31
                             g W   Ede+l+ av ++G+++W++I++ +
  Itr_sc010104.1_g00001.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLL 37
                             78************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.043238IPR017930Myb domain
SuperFamilySSF466893.43E-8336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-10536IPR009057Homeodomain-like
PfamPF002496.2E-7837IPR001005SANT/Myb domain
CDDcd001672.42E-51037No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 38 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_L3e-17237338Cell division cycle 5-like protein
5xjc_L3e-17237338Cell division cycle 5-like protein
5yzg_L3e-17237338Cell division cycle 5-like protein
5z56_L3e-17237338Cell division cycle 5-like protein
5z57_L3e-17237338Cell division cycle 5-like protein
5z58_L3e-17237338Cell division cycle 5-like protein
6ff4_L3e-17237338Cell division cycle 5-like protein
6ff7_L3e-17237338Cell division cycle 5-like protein
6icz_L3e-17237338Cell division cycle 5-like protein
6id0_L3e-17237338Cell division cycle 5-like protein
6id1_L3e-17237338Cell division cycle 5-like protein
6qdv_O3e-17237338Cell division cycle 5-like protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442159.14e-19cell division cycle 5-like protein
RefseqXP_008801722.13e-19cell division cycle 5-like protein
RefseqXP_008801723.13e-19cell division cycle 5-like protein
RefseqXP_009631530.13e-19PREDICTED: cell division cycle 5-like protein
RefseqXP_010039513.13e-19PREDICTED: cell division cycle 5-like protein isoform X1
RefseqXP_010039520.13e-19PREDICTED: cell division cycle 5-like protein isoform X2
RefseqXP_010246794.13e-19PREDICTED: cell division cycle 5-like protein
RefseqXP_010660227.13e-19PREDICTED: cell division cycle 5-like protein
RefseqXP_010914614.13e-19cell division cycle 5-like protein
RefseqXP_010914622.13e-19cell division cycle 5-like protein
RefseqXP_016455096.13e-19PREDICTED: cell division cycle 5-like protein
RefseqXP_016516169.12e-19PREDICTED: cell division cycle 5-like protein, partial
RefseqXP_016572257.13e-19PREDICTED: cell division cycle 5-like protein isoform X1
RefseqXP_020198485.13e-19cell division cycle 5-like protein isoform X1
RefseqXP_020198486.13e-19cell division cycle 5-like protein isoform X2
RefseqXP_022159233.13e-19cell division cycle 5-like protein
RefseqXP_022159234.13e-19cell division cycle 5-like protein
RefseqXP_022960954.13e-19cell division cycle 5-like protein isoform X1
RefseqXP_023533341.13e-19cell division cycle 5-like protein isoform X1
SwissprotP929482e-19CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A438E9043e-18A0A438E904_VITVI; Cell division cycle 5-like protein
TrEMBLA0A438J9H23e-18A0A438J9H2_VITVI; Cell division cycle 5-like protein
STRINGVIT_14s0036g00500.t015e-19(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.17e-22cell division cycle 5
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Li S, et al.
    MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis.
    Plant Cell, 2018. 30(2): p. 481-494
    [PMID:29437988]