PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc010104.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 38aa MW: 4379.27 Da PI: 10.689 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.4 | 1.9e-09 | 8 | 37 | 2 | 31 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartm 31 g W Ede+l+ av ++G+++W++I++ + Itr_sc010104.1_g00001.1 8 GVWKNTEDEILKAAVMKYGKNQWARISSLL 37 78************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.043 | 2 | 38 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.43E-8 | 3 | 36 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.5E-10 | 5 | 36 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.2E-7 | 8 | 37 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.42E-5 | 10 | 37 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 38 aa Download sequence Send to blast |
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
5xjc_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
5yzg_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
5z56_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
5z57_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
5z58_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6ff4_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6ff7_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6icz_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6id0_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6id1_L | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
6qdv_O | 3e-17 | 2 | 37 | 3 | 38 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002442159.1 | 4e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_008801722.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_008801723.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_009631530.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein | ||||
Refseq | XP_010039513.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein isoform X1 | ||||
Refseq | XP_010039520.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein isoform X2 | ||||
Refseq | XP_010246794.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein | ||||
Refseq | XP_010660227.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein | ||||
Refseq | XP_010914614.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_010914622.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_016455096.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein | ||||
Refseq | XP_016516169.1 | 2e-19 | PREDICTED: cell division cycle 5-like protein, partial | ||||
Refseq | XP_016572257.1 | 3e-19 | PREDICTED: cell division cycle 5-like protein isoform X1 | ||||
Refseq | XP_020198485.1 | 3e-19 | cell division cycle 5-like protein isoform X1 | ||||
Refseq | XP_020198486.1 | 3e-19 | cell division cycle 5-like protein isoform X2 | ||||
Refseq | XP_022159233.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_022159234.1 | 3e-19 | cell division cycle 5-like protein | ||||
Refseq | XP_022960954.1 | 3e-19 | cell division cycle 5-like protein isoform X1 | ||||
Refseq | XP_023533341.1 | 3e-19 | cell division cycle 5-like protein isoform X1 | ||||
Swissprot | P92948 | 2e-19 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A438E904 | 3e-18 | A0A438E904_VITVI; Cell division cycle 5-like protein | ||||
TrEMBL | A0A438J9H2 | 3e-18 | A0A438J9H2_VITVI; Cell division cycle 5-like protein | ||||
STRING | VIT_14s0036g00500.t01 | 5e-19 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 7e-22 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|