PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc006654.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MYB_related

Protein Properties

Length: 44aa MW: 4971.75 Da PI: 9.9277

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc006654.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.9	6.5e-10	14	43	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+W+t Ed+ll ++++q+G g+W++ +++ Itr_sc006654.1_g00001.1 14 KGPWSTKEDLLLTNYIQQHGEGQWRSLPKK 43 79***********************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-12	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.47E-8	8	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.756	9	44	IPR017930	Myb domain
Pfam	PF00249	2.4E-7	14	43	IPR001005	SANT/Myb domain
CDD	cd00167	3.51E-4	16	43	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 44 aa Download sequence Send to blast
MGRAPCCSKE GLKKGPWSTK EDLLLTNYIQ QHGEGQWRSL PKKA

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:19517001, ECO:0000305\|PubMed:12857823}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:12857823, ECO:0000269\|PubMed:19517001, ECO:0000269\|PubMed:8980549}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019200152.1	4e-24	PREDICTED: myb-related protein Myb4-like isoform X1
Refseq	XP_019200153.1	4e-24	PREDICTED: myb-related protein Myb4-like isoform X2
Swissprot	Q9LDR8	2e-16	MY102_ARATH; Transcription factor MYB102
TrEMBL	A0A328E3D0	1e-21	A0A328E3D0_9ASTE; Uncharacterized protein
STRING	Solyc08g082890.2.1	3e-21	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G21440.1	7e-19	MYB-like 102

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Zhu L,Guo J,Ma Z,Wang J,Zhou C Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis. Biomolecules, 2019. [PMID:29880735]