PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003213.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 538aa    MW: 60766.5 Da    PI: 7.0978
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003213.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS439.42.6e-1341105331374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                              lv+lL++c+++v++g+ e+a+ +L+++s+la++dgd+mqR+aayf eALa r+++ +++lykal++++ +  + ++e  ++k+f+e
  Itr_sc003213.1_g00002.1 110 LVHLLVTCVNHVAAGNIENANIVLEHISHLAASDGDSMQRVAAYFNEALADRILKGWPGLYKALKSTRIT--SAADENVVQKMFFE 193
                              68**************************************************************988887..488888999***** PP

                     GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                              ++P+l++s++++N+aI+ea+ege+ vHiiD+++ +++QW++Llqa++ Rpegpp++RiTg+++    +ke le+++++L++ Ae+l
  Itr_sc003213.1_g00002.1 194 LCPFLRLSYVITNEAIMEAMEGEKVVHIIDLNAFEPAQWISLLQAMSVRPEGPPHIRITGINE----HKEVLEQMAHQLNEAAEKL 275
                              ***************************************************************....9****************** PP

                     GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll............................................ 214
                              ++pf+fn+ +++rle+l++e+L vk gEa+a+++vlqlh +l                                            
  Itr_sc003213.1_g00002.1 276 DIPFQFNP-IVSRLESLSIESLPVKMGEAIAISSVLQLHPFLafddemlqrntppvvsrhansvhlqrilqvnprtlgdflekeva 360
                              ********.79*************************************************************************** PP

                     GRAS 215 ...........desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                                         +++++l+   +  ++L+ ++slsPk++v++eqea+hn+ s+++r +eal++y+alfd+le+++pr+s er+k+E+
  Itr_sc003213.1_g00002.1 361 npygaspdstsSSPLPLATapKMMSFLNSLWSLSPKIMVMTEQEANHNGFSLMDRTMEALNFYAALFDCLESTIPRASPERQKIEK 446
                              *******999844444443446778************************************************************* PP

                     GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                              ++ g+ei+n+++ceg er+erhe+lekW  rle +GF++v+ls+++++q ++ll+ ++ dgy++++++g+++++W+d+pL+svSaW
  Itr_sc003213.1_g00002.1 447 MVYGEEIKNIISCEGLERKERHEKLEKWIPRLELSGFRKVRLSYHIMMQGRRLLHSHNYDGYNLKDQDGCFLICWQDQPLFSVSAW 532
                              ************************************************************************************** PP

                     GRAS 374 r 374
                              r
  Itr_sc003213.1_g00002.1 533 R 533
                              8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.1784513IPR005202Transcription factor GRAS
PfamPF035148.9E-132110533IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MLGKVEALGK LASFLPAKPS QVVQIVILVT KRLKVRLLNE WPVGLLGLSR LQARVPKYNL  60
LMVAMVQEEG SSSIGSSPLQ YFSMMSLSPG IGSPYPWLGE MRSERRGLFL VHLLVTCVNH  120
VAAGNIENAN IVLEHISHLA ASDGDSMQRV AAYFNEALAD RILKGWPGLY KALKSTRITS  180
AADENVVQKM FFELCPFLRL SYVITNEAIM EAMEGEKVVH IIDLNAFEPA QWISLLQAMS  240
VRPEGPPHIR ITGINEHKEV LEQMAHQLNE AAEKLDIPFQ FNPIVSRLES LSIESLPVKM  300
GEAIAISSVL QLHPFLAFDD EMLQRNTPPV VSRHANSVHL QRILQVNPRT LGDFLEKEVA  360
NPYGASPDST SSSPLPLATA PKMMSFLNSL WSLSPKIMVM TEQEANHNGF SLMDRTMEAL  420
NFYAALFDCL ESTIPRASPE RQKIEKMVYG EEIKNIISCE GLERKERHEK LEKWIPRLEL  480
SGFRKVRLSY HIMMQGRRLL HSHNYDGYNL KDQDGCFLIC WQDQPLFSVS AWRFQRYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-421105334375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019185670.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_019185679.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_019185686.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A438GU360.0A0A438GU36_VITVI; Scarecrow-like protein 3
TrEMBLF6GX840.0F6GX84_VITVI; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]