PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc001455.1_g00008.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MYB

Protein Properties

Length: 131aa MW: 15206.6 Da PI: 8.8221

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc001455.1_g00008.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.3	4.8e-15	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l Itr_sc001455.1_g00008.1 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP
2	Myb_DNA-binding	36.2	1.4e-11	73	115	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k++++ W+tIa +g Rt+ qc +r+ k+l Itr_sc001455.1_g00008.1 73 EWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 115 6***************99.****8..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.008	2	57	IPR017930	Myb domain
SuperFamily	SSF46689	5.74E-15	4	59	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	8.4E-19	5	61	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF00249	5.7E-13	8	53	IPR001005	SANT/Myb domain
CDD	cd00167	6.86E-12	10	53	No hit	No description
CDD	cd11659	3.63E-29	55	118	No hit	No description
PROSITE profile	PS51294	14.028	65	119	IPR017930	Myb domain
SMART	SM00717	1.8E-10	70	117	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.7E-12	73	116	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.3E-12	73	120	IPR009057	Homeodomain-like
Pfam	PF13921	1.8E-10	74	122	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKA 60 TSPGDMFLNF LTEWTREEDE KLLHLAKLMP TQWRTIAPIV GRTPSQCLER YEKLLDAACA 120 KDENYEAGDD P

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
5xjc_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
5yzg_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
5z56_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
5z57_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
5z58_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6ff4_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6ff7_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6icz_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6id0_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6id1_L	2e-61	2	131	3	120	Cell division cycle 5-like protein
6qdv_O	2e-61	2	131	3	120	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015875524.1	5e-76	cell division cycle 5-like protein
Refseq	XP_019192775.1	7e-76	PREDICTED: cell division cycle 5-like protein isoform X1
Refseq	XP_019232628.1	5e-77	PREDICTED: cell division cycle 5-like protein
Refseq	XP_027104648.1	6e-76	cell division cycle 5-like protein
Swissprot	P92948	8e-75	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A067DSG9	4e-77	A0A067DSG9_CITSI; Uncharacterized protein
TrEMBL	B8ASH5	6e-77	B8ASH5_ORYSI; Uncharacterized protein
STRING	evm.model.supercontig_306.1	2e-76	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA17957	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	4e-77	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]