PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000746.1_g00012.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 179aa MW: 19545 Da PI: 7.3672 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 143.2 | 7.8e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear+rdPvyG+vg i+ lq+q Itr_sc000746.1_g00012.1 10 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVSSLAYEAEARVRDPVYGCVGAISYLQRQ 95 7************************************************************************************* PP DUF260 87 leqlkaelallke 99 +e+l++el+++++ Itr_sc000746.1_g00012.1 96 VERLQKELDAANA 108 ********99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.767 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.5E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MASSSSYSSP CAACKFLRRK CLPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVSSL AYEAEARVRD PVYGCVGAIS YLQRQVERLQ KELDAANADL IRYACNDVPP 120 PPQLPGGGMA PPSQGLRRGG TFHQRSGPVM SMGVHYPYPF PWDDDNNNNY PQGGGEGSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-68 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-68 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019185072.1 | 2e-91 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 2e-71 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A061FUD5 | 2e-86 | A0A061FUD5_THECC; Lateral organ boundaries domain family protein | ||||
STRING | EOY20851 | 3e-87 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 7e-70 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|