PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000497.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 63aa MW: 6953.12 Da PI: 10.2346 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 73 | 5.8e-23 | 15 | 61 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+CakdCv+apyfpa++p+kfa vhk+FGasnv kll+ Itr_sc000497.1_g00003.1 15 PCAACKLLRRRCAKDCVFAPYFPADEPHKFASVHKVFGASNVNKLLQ 61 7*******************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.069 | 14 | 63 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.8E-22 | 15 | 61 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MKESWRKQGG SAASPCAACK LLRRRCAKDC VFAPYFPADE PHKFASVHKV FGASNVNKLL 60 QVT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-21 | 11 | 61 | 7 | 57 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-21 | 11 | 61 | 7 | 57 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019157784.1 | 2e-37 | PREDICTED: LOB domain-containing protein 4-like | ||||
Swissprot | Q9SHE9 | 3e-31 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | M1AGH3 | 4e-32 | M1AGH3_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400022286 | 6e-33 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 1e-33 | LOB domain-containing protein 4 |