PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000482.1_g00008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 73aa MW: 8184.31 Da PI: 5.6347 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36 | 1.6e-11 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+WT+eEd +lv +++++G+g+W++++ Itr_sc000482.1_g00008.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTN 43 79************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-13 | 5 | 47 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.59E-10 | 8 | 43 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.1 | 9 | 53 | IPR017930 | Myb domain |
Pfam | PF00249 | 7.7E-10 | 14 | 43 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.01E-6 | 16 | 40 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTEARELT QGKSSLVGIE 60 SYLPLELPHW VNN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}. | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017621802.1 | 4e-26 | PREDICTED: myb-related protein 306-like isoform X1 | ||||
Swissprot | B3VTV7 | 4e-26 | MYB60_VITVI; Transcription factor MYB60 | ||||
Swissprot | Q8GYP5 | 2e-26 | MYB60_ARATH; Transcription factor MYB60 | ||||
TrEMBL | A0A0A0LQ55 | 5e-25 | A0A0A0LQ55_CUCSA; Uncharacterized protein | ||||
STRING | XP_006482590.1 | 2e-25 | (Citrus sinensis) | ||||
STRING | fgenesh1_pg.C_scaffold_1003053 | 1e-25 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 7e-29 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|