PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000473.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 590aa    MW: 63959.8 Da    PI: 4.9558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000473.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-1767114148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Itr_sc000473.1_g00002.1  67 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 114
                              79******************************************9986 PP

2Myb_DNA-binding37.74.6e-12120173146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqk 46 
                              +g++T+eE+ +++++++++G++ W++ a++            gRt++++k++w++
  Itr_sc000473.1_g00002.1 120 KGAFTPEEESRIIELHAKMGNK-WARMAAEPIlplsssfqlPGRTDNEIKNYWNT 173
                              799*******************.******98888*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.6462118IPR017930Myb domain
SuperFamilySSF466891.95E-2665171IPR009057Homeodomain-like
SMARTSM007171.7E-1366116IPR001005SANT/Myb domain
PfamPF002494.6E-1567114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2468121IPR009057Homeodomain-like
CDDcd001676.04E-1169114No hitNo description
SMARTSM007172.0E-11119177IPR001005SANT/Myb domain
PROSITE profilePS5129415.419119179IPR017930Myb domain
PfamPF002492.0E-10120173IPR001005SANT/Myb domain
CDDcd001678.05E-9122173No hitNo description
Gene3DG3DSA:1.10.10.601.2E-23122178IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MTDYYSSFQD SSMKTESEDK MTHYYSSFQD SSMKTESEDK MTSKGGISED TTGGGNAGSI  60
GGKALKKGPW TSAEDAILVE YVTKHGEGNW NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK  120
GAFTPEEESR IIELHAKMGN KWARMAAEPI LPLSSSFQLP GRTDNEIKNY WNTRIKRRQR  180
AGLPIYPPDI CLKALNESKQ NEDFSTFPNG GTHHPDLLQI NNFEIPAVEF RSLEVNQQLY  240
PPALLEIPSS SLLDIPASSL LAHGLNSSYG NRSVLSTMHP SKRIRGSEPL FPGLNVNASD  300
ILPACSPYQN DGSVEIAQSF GFSSAYDQNL ASGHSSFSGV ISGSHASLNG NSSSLEPTWA  360
KKLELPSFQS QMGSWGSPSS PLPSLESVDT LIQSPPTEHN TGSGSLSPRN SGLLDAVLYE  420
SQTLKHTKSN SSEQTSGAFM MPGDIMDSSC PDLHGTELEA YGDPISPLGH SVASVFSEYT  480
AISGSSLDEP QSVETMPGDK VKQEDAGSAS VQCDDKNDAS NQDEMFSRPD FLLDSNCFDM  540
KADHGKNHSI LKDAFGAVLF DDFSKDCKKM GAVTTSTGQD SCAWDAMSTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28651785107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019199194.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A068UQ740.0A0A068UQ74_COFCA; Uncharacterized protein
STRINGXP_009786742.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.35e-84myb domain protein 33