PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000442.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family STAT
Protein Properties Length: 716aa    MW: 79969.8 Da    PI: 6.5832
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000442.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT185.37.9e-582253451121
                     STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrik 86 
                              ldv+ll+alg+p++k++ev asL+yads ++vek+ d eapLL+sydG+ef s+drp+k+++GrasfklkisqLssk+dnrLfrik
  Itr_sc000442.1_g00004.1 225 LDVMLLDALGRPANKELEVFASLVYADSEAPVEKPPDGEAPLLTSYDGLEFDSSDRPSKMIQGRASFKLKISQLSSKSDNRLFRIK 310
                              8************************************************************************************* PP

                     STAT  87 feipklkkypfleavskpirCisrsrntrsssltk 121
                              f i+k  +ypflea+s pirCisrsr++r+ss+t 
  Itr_sc000442.1_g00004.1 311 FGIQKTGRYPFLEALSIPIRCISRSRTSRPSSVTR 345
                              ******************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF133851.8E-624174No hitNo description
Gene3DG3DSA:2.60.120.2002.4E-526176IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498997.24E-727146IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.101.1E-5612681IPR000980SH2 domain
SuperFamilySSF555501.35E-6616683IPR000980SH2 domain
PROSITE profilePS500019.426620716IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MGMDEVGSYG LLKDLKLEFK EVEDTVQNGG ITLCFWLYLN NPTALPSTIL HQAHPDIASN  60
APFLLLDEQS RIVLFPLIFL HQEASSPSNA ISSKQIPCAS NKNEFPVKKW VHIACEISQV  120
ILRLHIDGEI VGERPLTSSL DNDLHSDVSK KVSLCSIRGN DDGLQGYVHG IELFHQDSSI  180
RSHYLKDSPL QLSIDSSSAY EIDEYSDGVW SIVGGKASCR KNFSLDVMLL DALGRPANKE  240
LEVFASLVYA DSEAPVEKPP DGEAPLLTSY DGLEFDSSDR PSKMIQGRAS FKLKISQLSS  300
KSDNRLFRIK FGIQKTGRYP FLEALSIPIR CISRSRTSRP SSVTRKKSPS SIHLLNRSQS  360
PGLDGGLPEV LHNIVHEAKQ SPSSKRVKLG QEKSLAVLKD DCILKEADEE SKSHMWTTNE  420
DNNNAYKTGA VGRPESRDGA ENFSSDSENS EATNSVPGNF SPHKGPISDL IVFKYCLGGL  480
SERCLLLKEI AMTYKEEALG SFAEQVSLFS GCSHHRRQIL ISKRLIEDGI KCWSFISRNS  540
HNVLWDNLVT GLQDHFMKLT FCATRSLTRQ DFEILRRIAG CQEMVSQENF EKMWCWLYPV  600
AFTLSQKQMN SLWSSLSPKW MEGFITKEEA ESSLLGPGGV QAPGTFILRF PISRSWPHTD  660
AGTLVVTYVG SDYSIHHRLL SHESVYCSKE MTGKPLQEML LEEPELSRLG RTVRSQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019153972.10.0PREDICTED: uncharacterized protein LOC109150505
TrEMBLA0A484LW540.0A0A484LW54_9ASTE; Uncharacterized protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B