PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000422.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 515aa    MW: 56526.7 Da    PI: 5.0263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000422.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-163885148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT  Ed +l ++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Itr_sc000422.1_g00005.1 38 KGPWTSAEDAILMEYVTRHGEGNWNAVQKHTGLARCGKSCRLRWANHL 85
                             79******************************************9986 PP

2Myb_DNA-binding52.61e-1691134146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Itr_sc000422.1_g00005.1  91 KGAFTPEEEHRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 134
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8263385IPR017930Myb domain
SuperFamilySSF466898.59E-3035132IPR009057Homeodomain-like
SMARTSM007174.9E-123787IPR001005SANT/Myb domain
PfamPF002491.3E-143885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-243992IPR009057Homeodomain-like
CDDcd001676.82E-104085No hitNo description
PROSITE patternPS0017505362IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129426.07786140IPR017930Myb domain
SMARTSM007175.0E-1590138IPR001005SANT/Myb domain
PfamPF002491.0E-1591134IPR001005SANT/Myb domain
CDDcd001677.08E-1193134No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2693139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MSITSESEDN MTMKGNVNSP SVEEATGGAN AGGVPLKKGP WTSAEDAILM EYVTRHGEGN  60
WNAVQKHTGL ARCGKSCRLR WANHLKPDLK KGAFTPEEEH RIIELHAKMG NKWARMAAEL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPIYPPD VHLQAIHESN QNEDMSTFST GDTQHSNLLQ  180
VNYFEIPAVE FKNLELNQQL HPQSPLDIPA SSLLAQGLNS SYGPRPFFST MNPSKRLRGP  240
DSLFTGLSSN DSDIFTAFGP YQSDTCMQVS QSSGFSSGYY QNLDPDHPSL SCVIPGSHAS  300
LNSNSSSLEP AWAKKPELPS LQSQIGSWDA PSSPLPSLES VETLIQSPPT ERSESGNVSP  360
RNSGLLEAVL YESQTLKNSK NTLPQQNSDA SMIPSDIVDN TFPDFHEAEW EGYADPISPL  420
GHSAASVFNE YTPISSLEEH QSVEMLAGCK FTQEDAPLAP MQCDDKDDAL NQIFSRPDFL  480
LDSNCFGTAH EGALVTCHHC ANIVHGLCTM ITHAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31331391107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. Required for anther development (PubMed:19454733, PubMed:20590996). Functions in parallel with UDT1 to regulate early anther development. Functions upstream of the transcription factor TDR and may positively regulate its transcription (PubMed:20590996). Required for pollen development. Probably required for controlling tapetal cell size and promoting tapetal programmed cell death (PCD) during anther development. Required for exine and Ubisch body formation in anthers. Interacts with the DNA specific motifs of giberrellin-up-regulated genes of anthers and regulates their expression. Positively regulates the expression of the laurate hydroxylase CYP703A3, known to be essential for the development of pollen exine and anther epicuticular layer (PubMed:19454733). Functions with MYBS1 to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of GAMYB and MYBS1, resulting in the expression of a large set of GA-inducible hydrolases, transporters and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:14688295, ECO:0000269|PubMed:19454733, ECO:0000269|PubMed:20590996, ECO:0000269|PubMed:22773748}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:14688295}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019197843.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_019197844.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_019197845.10.0PREDICTED: transcription factor GAMYB-like
SwissprotQ0JIC22e-94GAMYB_ORYSJ; Transcription factor GAMYB
TrEMBLA0A068UQ740.0A0A068UQ74_COFCA; Uncharacterized protein
STRINGXP_009596031.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-81myb domain protein 33
Publications ? help Back to Top
  1. Gocal GF, et al.
    Long-day up-regulation of a GAMYB gene during Lolium temulentum inflorescence formation.
    Plant Physiol., 1999. 119(4): p. 1271-8
    [PMID:10198085]
  2. Ueguchi-Tanaka M, et al.
    Rice dwarf mutant d1, which is defective in the alpha subunit of the heterotrimeric G protein, affects gibberellin signal transduction.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11638-43
    [PMID:11027362]
  3. Sutoh K,Yamauchi D
    Two cis-acting elements necessary and sufficient for gibberellin-upregulated proteinase expression in rice seeds.
    Plant J., 2003. 34(5): p. 635-45
    [PMID:12787245]
  4. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  5. Washio K
    Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone.
    Plant Physiol., 2003. 133(2): p. 850-63
    [PMID:14500792]
  6. Eastmond PJ,Jones RL
    Hormonal regulation of gluconeogenesis in cereal aleurone is strongly cultivar-dependent and gibberellin action involves SLENDER1 but not GAMYB.
    Plant J., 2005. 44(3): p. 483-93
    [PMID:16236157]
  7. Xie Z, et al.
    Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells.
    Plant J., 2006. 46(2): p. 231-42
    [PMID:16623886]
  8. Tsuji H, et al.
    GAMYB controls different sets of genes and is differentially regulated by microRNA in aleurone cells and anthers.
    Plant J., 2006. 47(3): p. 427-44
    [PMID:16792694]
  9. Wang Y,Wang YF,Zhang DB
    [Identification of the rice (Oryza sativa L.) mutant msp1-4 and expression analysis of its UDT1 and GAMYB genes].
    Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2006. 32(5): p. 527-34
    [PMID:17075175]
  10. Liu SM,Wang ZY,Cai XL
    [Preliminary screening of target genes of rice transcription factor OsBP-73].
    Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2007. 33(5): p. 456-62
    [PMID:17960050]
  11. Aya K, et al.
    Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB.
    Plant Cell, 2009. 21(5): p. 1453-72
    [PMID:19454733]
  12. Hu L,Tan H,Liang W,Zhang D
    The Post-meiotic Deficicent Anther1 (PDA1) gene is required for post-meiotic anther development in rice.
    J Genet Genomics, 2010. 37(1): p. 37-46
    [PMID:20171576]
  13. Liu Z,Bao W,Liang W,Yin J,Zhang D
    Identification of gamyb-4 and analysis of the regulatory role of GAMYB in rice anther development.
    J Integr Plant Biol, 2010. 52(7): p. 670-8
    [PMID:20590996]
  14. Plackett AR,Thomas SG,Wilson ZA,Hedden P
    Gibberellin control of stamen development: a fertile field.
    Trends Plant Sci., 2011. 16(10): p. 568-78
    [PMID:21824801]
  15. Aya K, et al.
    The Gibberellin perception system evolved to regulate a pre-existing GAMYB-mediated system during land plant evolution.
    Nat Commun, 2011. 2: p. 544
    [PMID:22109518]
  16. Hong YF, et al.
    Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.
    Plant Cell, 2012. 24(7): p. 2857-73
    [PMID:22773748]
  17. Wang Y, et al.
    TamiR159 directed wheat TaGAMYB cleavage and its involvement in anther development and heat response.
    PLoS ONE, 2012. 7(11): p. e48445
    [PMID:23133634]
  18. Zhang Y, et al.
    GmGBP1, a homolog of human ski interacting protein in soybean, regulates flowering and stress tolerance in Arabidopsis.
    BMC Plant Biol., 2013. 13: p. 21
    [PMID:23388059]
  19. Zhang Y, et al.
    A GAMYB homologue CsGAMYB1 regulates sex expression of cucumber via an ethylene-independent pathway.
    J. Exp. Bot., 2014. 65(12): p. 3201-13
    [PMID:24790111]
  20. Yano K, et al.
    Comprehensive gene expression analysis of rice aleurone cells: probing the existence of an alternative gibberellin receptor.
    Plant Physiol., 2015. 167(2): p. 531-44
    [PMID:25511432]
  21. Sutoh K, et al.
    An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds.
    Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59
    [PMID:25559339]
  22. Kwon CT,Kim SH,Kim D,Paek NC
    The Rice Floral Repressor Early flowering1 Affects Spikelet Fertility By Modulating Gibberellin Signaling.
    Rice (N Y), 2015. 8(1): p. 58
    [PMID:26202549]
  23. Suzuki A, et al.
    Cloning and expression of five myb-related genes from rice seed.
    Gene, 1997. 198(1-2): p. 393-8
    [PMID:9370307]