PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000367.1_g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 297aa    MW: 33414.9 Da    PI: 6.9722
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000367.1_g00035.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-102873346
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                             +WT+eE +++ da +++ ++   +W+ +a++++ g+t ++++  ++ 
  Itr_sc000367.1_g00035.1 28 KWTAEENKRFEDALALFDKDtpdRWHNVAAMIP-GKTVNDVIRQYRE 73
                             8********************************.********99986 PP

2Myb_DNA-binding44.63.3e-14139183347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ + k++G+g+W+ I+r + + Rt+ q+ s+ qky
  Itr_sc000367.1_g00035.1 139 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTSRTPTQVASHAQKY 183
                              8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-51974IPR009057Homeodomain-like
PROSITE profilePS512938.1362478IPR017884SANT domain
SMARTSM007178.0E-112577IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-122781IPR009057Homeodomain-like
CDDcd001676.64E-92875No hitNo description
PfamPF002498.4E-92874IPR001005SANT/Myb domain
PROSITE profilePS5129420.736132188IPR017930Myb domain
SuperFamilySSF466893.87E-17134187IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-18135187IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-12136183IPR009057Homeodomain-like
SMARTSM007176.0E-13136186IPR001005SANT/Myb domain
CDDcd001672.20E-11139184No hitNo description
PfamPF002491.7E-11139183IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSQEMGILSS ETYLSDSNWL FDEAKASKWT AEENKRFEDA LALFDKDTPD RWHNVAAMIP  60
GKTVNDVIRQ YRELVADVSD IEAGLIPIPG YATSHSFTLE WVDSHSHGGY DAYRQFYAPP  120
GKRSNSSRSS DHERKKGVPW TEEEHRQFLL GLKKYGKGDW RNISRNFVTS RTPTQVASHA  180
QKYFIRQLSG GKDKRRSSIH DITTVNLSET KSPSPDNNIN TCSSDKPAPQ VLTTPPLSNN  240
HGGVSITFDS QYGSLITATA ATFQGTSSYG LNLHEHNNMQ YNNNINLHGL QFQMQPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1729941176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019186301.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-102DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1J6I7841e-133A0A1J6I784_NICAT; Transcription factor myb1r1
STRINGXP_009786719.11e-131(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-108MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]