PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000337.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 211aa MW: 23510.9 Da PI: 6.7794 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.7 | 6.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELSvLCda++a+i+fs tgkly++ss Itr_sc000337.1_g00005.1 9 KKIDNITARQVTFSKRRRGLFKKAQELSVLCDAQIALIVFSATGKLYDFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 36.8 | 1.7e-13 | 92 | 161 | 18 | 87 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 + + +L kei +e R l+Ge+L+ Ls++eLqqLe++Le +l+++ ++K lle+ ++l++k ++ Itr_sc000337.1_g00005.1 92 NSLHVRLSKEIADKTHEFRMLKGEELQGLSIEELQQLEKRLEVGLSRVVETKGAELLEENKQLRQKVAMI 161 44566899999999999*************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.76E-31 | 3 | 80 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.72E-32 | 12 | 75 | No hit | No description |
PRINTS | PR00404 | 1.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.999 | 88 | 196 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.6E-10 | 97 | 161 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAQELSVLCD AQIALIVFSA TGKLYDFSSS 60 SMKDILGKYK LHSSDNNEKT NLQPSLELQL ENSLHVRLSK EIADKTHEFR MLKGEELQGL 120 SIEELQQLEK RLEVGLSRVV ETKGAELLEE NKQLRQKVAM IGDGKFPASA DVECMVAEEG 180 ISSESITTNV NSCSSAPPAE DYCSDTSLKL G |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 81 | 1 | 81 | MEF2C |
5f28_B | 4e-20 | 1 | 81 | 1 | 81 | MEF2C |
5f28_C | 4e-20 | 1 | 81 | 1 | 81 | MEF2C |
5f28_D | 4e-20 | 1 | 81 | 1 | 81 | MEF2C |
6byy_A | 5e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6byy_B | 5e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6byy_C | 5e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6byy_D | 5e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6bz1_A | 4e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6bz1_B | 4e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6bz1_C | 4e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
6bz1_D | 4e-20 | 1 | 81 | 1 | 81 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019155989.1 | 1e-131 | PREDICTED: MADS-box protein AGL24-like | ||||
Swissprot | O82794 | 1e-75 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | A0A2U8UAB9 | 1e-140 | A0A2U8UAB9_IPOBA; MBP8 | ||||
STRING | EOY15444 | 2e-94 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 4e-78 | AGAMOUS-like 24 |