PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000337.1_g00005.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MIKC_MADS

Protein Properties

Length: 211aa MW: 23510.9 Da PI: 6.7794

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000337.1_g00005.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.7	6.6e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELSvLCda++a+i+fs tgkly++ss Itr_sc000337.1_g00005.1 9 KKIDNITARQVTFSKRRRGLFKKAQELSVLCDAQIALIVFSATGKLYDFSS 59 68***********************************************96 PP
2	K-box	36.8	1.7e-13	92	161	18	87
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 + + +L kei +e R l+Ge+L+ Ls++eLqqLe++Le +l+++ ++K lle+ ++l++k ++ Itr_sc000337.1_g00005.1 92 NSLHVRLSKEIADKTHEFRMLKGEELQGLSIEELQQLEKRLEVGLSRVVETKGAELLEENKQLRQKVAMI 161 44566899999999999*************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.6E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.109	1	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-26	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.76E-31	3	80	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.1E-25	10	57	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.72E-32	12	75	No hit	No description
PRINTS	PR00404	1.8E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-26	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	8.999	88	196	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.6E-10	97	161	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 211 aa Download sequence Send to blast
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAQELSVLCD AQIALIVFSA TGKLYDFSSS 60 SMKDILGKYK LHSSDNNEKT NLQPSLELQL ENSLHVRLSK EIADKTHEFR MLKGEELQGL 120 SIEELQQLEK RLEVGLSRVV ETKGAELLEE NKQLRQKVAM IGDGKFPASA DVECMVAEEG 180 ISSESITTNV NSCSSAPPAE DYCSDTSLKL G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-20	1	81	1	81	MEF2C
5f28_B	4e-20	1	81	1	81	MEF2C
5f28_C	4e-20	1	81	1	81	MEF2C
5f28_D	4e-20	1	81	1	81	MEF2C
6byy_A	5e-20	1	81	1	81	MEF2 CHIMERA
6byy_B	5e-20	1	81	1	81	MEF2 CHIMERA
6byy_C	5e-20	1	81	1	81	MEF2 CHIMERA
6byy_D	5e-20	1	81	1	81	MEF2 CHIMERA
6bz1_A	4e-20	1	81	1	81	MEF2 CHIMERA
6bz1_B	4e-20	1	81	1	81	MEF2 CHIMERA
6bz1_C	4e-20	1	81	1	81	MEF2 CHIMERA
6bz1_D	4e-20	1	81	1	81	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18694458}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019155989.1	1e-131	PREDICTED: MADS-box protein AGL24-like
Swissprot	O82794	1e-75	AGL24_ARATH; MADS-box protein AGL24
TrEMBL	A0A2U8UAB9	1e-140	A0A2U8UAB9_IPOBA; MBP8
STRING	EOY15444	2e-94	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA938	23	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24540.1	4e-78	AGAMOUS-like 24

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Sun LM,Zhang JZ,Hu CG Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.). Front Plant Sci, 2016. 7: p. 823 [PMID:27375669]