PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000322.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 437aa    MW: 49482.7 Da    PI: 7.1358
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000322.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS430.11.7e-131414341374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                              l++lLl+cA++v++g l  a+ +L ++s+laspdgd+mqR+a+yf+eALa r++rs+++lykal++++ +     ++++a k++++
  Itr_sc000322.1_g00012.1  41 LIHLLLTCANHVAAGALDSANVALDQISHLASPDGDTMQRIASYFAEALADRILRSWPGLYKALHSTRLP--VLPDQVTAKKMLYD 124
                              689*************************************************************999998..599999******** PP

                     GRAS  87 vsPilkf...........shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleet 161
                              ++P+lk+           +++++NqaI ea+ege+ vHiiD+++ +++QW +Ll+ L++Rpegpp+lRiTgv++    ++e l ++
  Itr_sc000322.1_g00012.1 125 LFPFLKVhgaglsnpvqvAFMVTNQAIIEAMEGEKLVHIIDLNAVEPTQWRPLLRDLSARPEGPPHLRITGVHP----HREPLDQM 206
                              ****9753333333333289******************************************************....9******* PP

                     GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll...............desvsles.erdevLklv 231
                              ++ L++ Ae+l++pf+f++ ++++le+l++++Lrvk+gEala+ ++l+lh+ll                +  sle+ +++ +L+++
  Itr_sc000322.1_g00012.1 207 ARTLTDEAEKLDIPFQFTP-IVTHLETLDFQQLRVKTGEALAITSSLKLHTLLahnhepgknpnpqrlGDINSLENhKIKGFLDAI 291
                              *******************.799******************************************9994444444446899***** PP

                     GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                              ++lsPk+vv++eqe++hn+e++++r++e+l+yy+a+fd+le++lpr+s++r k E+ llg+ei+n++aceg er+erhe+l kW  
  Itr_sc000322.1_g00012.1 292 RGLSPKIVVISEQESNHNGETLMQRLSESLHYYAAFFDCLESTLPRTSSDRLKAEKLLLGEEIKNIIACEGIERKERHEKLDKWFW 377
                              ************************************************************************************** PP

                     GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              r++++GF +vpls++a+ qa++ l+ +  dgy+v+ee+g++v++W+dr+L+svS+Wr
  Itr_sc000322.1_g00012.1 378 RFGSSGFWNVPLSYYAMLQARRYLQSCRCDGYNVKEENGCVVICWQDRALFSVSCWR 434
                              ********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.415414IPR005202Transcription factor GRAS
PfamPF035145.9E-12941434IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MFQDNDGSSS ITSLSPRMPA GFGSLSHWFK ELKPEERGLY LIHLLLTCAN HVAAGALDSA  60
NVALDQISHL ASPDGDTMQR IASYFAEALA DRILRSWPGL YKALHSTRLP VLPDQVTAKK  120
MLYDLFPFLK VHGAGLSNPV QVAFMVTNQA IIEAMEGEKL VHIIDLNAVE PTQWRPLLRD  180
LSARPEGPPH LRITGVHPHR EPLDQMARTL TDEAEKLDIP FQFTPIVTHL ETLDFQQLRV  240
KTGEALAITS SLKLHTLLAH NHEPGKNPNP QRLGDINSLE NHKIKGFLDA IRGLSPKIVV  300
ISEQESNHNG ETLMQRLSES LHYYAAFFDC LESTLPRTSS DRLKAEKLLL GEEIKNIIAC  360
EGIERKERHE KLDKWFWRFG SSGFWNVPLS YYAMLQARRY LQSCRCDGYN VKEENGCVVI  420
CWQDRALFSV SCWRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-66294367381Protein SCARECROW
5b3h_A2e-66294366380Protein SCARECROW
5b3h_D2e-66294366380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019157864.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A484N6A00.0A0A484N6A0_9ASTE; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]