PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000281.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 298aa    MW: 33138 Da    PI: 7.9187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000281.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.1e-082266345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             +W++ E + + +a +++ ++   +W+++a++++ g+t  +++  + 
  Itr_sc000281.1_g00008.1 22 KWSPAENKAFEKALALYDKDtpdRWERVAEMVP-GKTVGDVIRQYK 66
                             8********************************.****99998876 PP

2Myb_DNA-binding461.2e-14129173347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qk+
  Itr_sc000281.1_g00008.1 129 PWTEEEHKLFLMGLKKHGKGDWRNISRNFVITRTPTQVASHAQKF 173
                              8*****************************99***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.9411871IPR017884SANT domain
SMARTSM007175.3E-101971IPR001005SANT/Myb domain
SuperFamilySSF466893.8E-112176IPR009057Homeodomain-like
CDDcd001675.48E-82268No hitNo description
PfamPF002496.6E-72267IPR001005SANT/Myb domain
PROSITE profilePS5129419.645122178IPR017930Myb domain
SuperFamilySSF466896.96E-17124178IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-16125177IPR006447Myb domain, plants
SMARTSM007171.0E-12126176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-12126169IPR009057Homeodomain-like
CDDcd001673.31E-11129174No hitNo description
PfamPF002491.5E-12129172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGILSPDSSY LSSSSWFHEG TKWSPAENKA FEKALALYDK DTPDRWERVA EMVPGKTVGD  60
VIRQYKELED DVTSIEAGLM DLIPIPDYTT SSPFTLEWGG AHRPAFVAGG GKRPPANRAP  120
EHERKKGVPW TEEEHKLFLM GLKKHGKGDW RNISRNFVIT RTPTQVASHA QKFFIRQNSG  180
GKDKRRASIH DITTVSIDEH HQMASPDTKK RCDDSPDQAG VALSQPQQQQ QPDSGVHKRP  240
FSWNHQGNIG MAISGFSSAS PGNLFAYAFG PQTMHESIFG SQTMAFPIQS AAQQYPFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-162091876RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019178778.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-106DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1U8H2M51e-116A0A1U8H2M5_CAPAN; transcription factor DIVARICATA-like
STRINGPGSC0003DMT4000780291e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-92Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]