PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000277.1_g00004.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NAC

Protein Properties

Length: 294aa MW: 33325.6 Da PI: 6.6738

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000277.1_g00004.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	182.2	1.3e-56	20	146	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 +ppGfrFhPtdeel+++yL++kv+++++ + ++ evd++kvePwdLp ++k +ekewyfF+ rd+ky+tg+r+nrat++gyWkat Itr_sc000277.1_g00004.1 20 MPPGFRFHPTDEELISHYLCPKVADSSFCA-AAMGEVDLNKVEPWDLPWRAKMGEKEWYFFCVRDRKYPTGQRTNRATEAGYWKAT 104 79***********************988.78***********888999**************************** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 gkdke+++ ++lvg+kktLvfykgrap+g+kt+Wvmheyrle Itr_sc000277.1_g00004.1 105 GKDKEIFR-AKTLVGMKKTLVFYKGRAPRGHKTNWVMHEYRLE 146 ****.999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.07E-63	17	166	IPR003441	NAC domain
PROSITE profile	PS51005	59.225	20	166	IPR003441	NAC domain
Pfam	PF02365	5.5E-30	21	145	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0010029	Biological Process	regulation of seed germination
GO:0042542	Biological Process	response to hydrogen peroxide
GO:0043068	Biological Process	positive regulation of programmed cell death
GO:0048527	Biological Process	lateral root development
GO:0051091	Biological Process	positive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400	Biological Process	stress-induced premature senescence
GO:1900057	Biological Process	positive regulation of leaf senescence
GO:1902074	Biological Process	response to salt
GO:1904250	Biological Process	positive regulation of age-related resistance
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 294 aa Download sequence Send to blast
MENTSGSAFS GVEEEMELQM PPGFRFHPTD EELISHYLCP KVADSSFCAA AMGEVDLNKV 60 EPWDLPWRAK MGEKEWYFFC VRDRKYPTGQ RTNRATEAGY WKATGKDKEI FRAKTLVGMK 120 KTLVFYKGRA PRGHKTNWVM HEYRLEGNYS IPTHKNEWVI CRVFKKTAGG HKIHISGLTR 180 GENLPALMEV SQRTATSGEA MAPHVTCFSD SKEDKKPIIA PPHFSSPSPS SKNSDFSGVF 240 PGLEFQHYSE PDENSVLRLW LENNGLQAKQ GNDDDEFLMS SANGPVDLDC LWNY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	4e-57	11	172	8	174	NAC domain-containing protein 19
3swm_B	4e-57	11	172	8	174	NAC domain-containing protein 19
3swm_C	4e-57	11	172	8	174	NAC domain-containing protein 19
3swm_D	4e-57	11	172	8	174	NAC domain-containing protein 19
3swp_A	4e-57	11	172	8	174	NAC domain-containing protein 19
3swp_B	4e-57	11	172	8	174	NAC domain-containing protein 19
3swp_C	4e-57	11	172	8	174	NAC domain-containing protein 19
3swp_D	4e-57	11	172	8	174	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00535	DAP	Transfer from AT5G39610	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB849126	0.0	AB849126.1 Ipomoea nil EPHEMERAL1 mRNA for NAC transcription factor, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019195564.1	0.0	PREDICTED: NAC domain-containing protein 92-like
Swissprot	Q9FKA0	1e-106	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A077JIT7	0.0	A0A077JIT7_IPONI; NAC transcription factor
STRING	PGSC0003DMT400003380	1e-126	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA152	24	279

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	1e-107	NAC domain containing protein 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]