PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000218.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 271aa    MW: 30521.6 Da    PI: 9.8248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000218.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.9e-101865146
                             TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                             r rWT+eE +l+  a ++   +   +W ++a++++ g++  ++++r+q 
  Itr_sc000218.1_g00003.1 18 RTRWTKEENKLFESALAMIDERtpdRWVRVAHMVP-GKSVSDVINRFQE 65
                             78*********************************.***********97 PP

2Myb_DNA-binding39.21.6e-12117161347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ +  ++G+g+W+ I+r     +t+ q+ s+ qky
  Itr_sc000218.1_g00003.1 117 PWTEEEHRRFLMGLDKYGKGDWRNISRNYVISKTPTQVASHAQKY 161
                              8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.8641767IPR017877Myb-like domain
SMARTSM007171.1E-91769IPR001005SANT/Myb domain
PfamPF002491.4E-81866IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-41866IPR009057Homeodomain-like
SuperFamilySSF466891.65E-111974IPR009057Homeodomain-like
CDDcd001674.16E-72066No hitNo description
Gene3DG3DSA:1.10.10.606.4E-11108165IPR009057Homeodomain-like
PROSITE profilePS5129419.635110166IPR017930Myb domain
SuperFamilySSF466891.58E-16111165IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-19113165IPR006447Myb domain, plants
SMARTSM007171.3E-10114164IPR001005SANT/Myb domain
CDDcd001673.15E-9117162No hitNo description
PfamPF002499.0E-11117161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
METLMLPNSS WLMQPGRRTR WTKEENKLFE SALAMIDERT PDRWVRVAHM VPGKSVSDVI  60
NRFQELAADV SNIEAGLVPV PGYLASSFPV ELVDDRGFPG FRKRGRGCDQ ERKKGVPWTE  120
EEHRRFLMGL DKYGKGDWRN ISRNYVISKT PTQVASHAQK YFLRQLSGSK DKRRPSIHDI  180
TTFNLADPNP SEAAKKSVLD EKSVRGTLVP KTIADTPELE SWNFPDDGAD AVAASMFRVP  240
ADSSFVAYPS QVGYAKFGLG INPTRYQTLR G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101113RKRGRGCDQERKK
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019151357.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-80DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068V2E51e-103A0A068V2E5_COFCA; Uncharacterized protein
STRINGXP_009627320.11e-101(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-78MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]