Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 148 | 4.8e-46 | 26 | 153 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknr.atksgyWk 84
pGfrFhPtdeelvv+yL++kv+gk++++ e+i+ vdiyk+ePw+L+ ++v+++++ewyf + +kky+ ++ nr t++gyWk
Itr_sc000102.1_g00018.1 26 GPGFRFHPTDEELVVYYLRRKVRGKPFHV-EAISVVDIYKHEPWELHafSAVNSTDQEWYFLVDLEKKYKGSRLINRsFTEKGYWK 110
59***************************.89**************85348888999************9999999989******* PP
NAM 85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
++ kd++v + k+e vg+kktLv++ g+ p+g++t+Wvmheyrl
Itr_sc000102.1_g00018.1 111 TSEKDQTVSH-KREIVGMKKTLVYHAGKPPNGRRTNWVMHEYRL 153
********99.8999***************************98 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 6e-37 | 25 | 178 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-37 | 25 | 178 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-37 | 25 | 178 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-37 | 25 | 178 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 6e-37 | 25 | 178 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 6e-37 | 25 | 178 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 6e-37 | 25 | 178 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}. |
UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}. |