PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000099.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family MYB
Protein Properties Length: 168aa    MW: 19618.1 Da    PI: 7.753
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000099.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.4e-091559345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             +WT  Ed+ +  +  ++G +   +W +Ia+ ++  +t+ ++  ++q
  Itr_sc000099.1_g00013.1 15 NWTRHEDKMFEVGLVRYGEEridRWVKIAELLP-LKTARDVEQHYQ 59
                             8******************9*************.9**********9 PP

2Myb_DNA-binding52.41.2e-1699143347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               WT+eE+++++++ +++G+g+Wk+Iar   k+R++ q+ s+ qky
  Itr_sc000099.1_g00013.1  99 QWTAEEHKRFLEGLNRYGKGDWKSIARQCVKTRSATQVASHAQKY 143
                              5*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.3E-81264IPR001005SANT/Myb domain
SuperFamilySSF466894.97E-101467IPR009057Homeodomain-like
PROSITE profilePS500906.9461562IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-51562IPR009057Homeodomain-like
PfamPF002497.0E-71559IPR001005SANT/Myb domain
CDDcd001672.65E-71562No hitNo description
Gene3DG3DSA:1.10.10.606.6E-1191150IPR009057Homeodomain-like
PROSITE profilePS5129416.01792148IPR017930Myb domain
SuperFamilySSF466894.21E-1893149IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-1695146IPR006447Myb domain, plants
SMARTSM007177.5E-796146IPR001005SANT/Myb domain
PfamPF002492.5E-1399143IPR001005SANT/Myb domain
CDDcd001671.63E-9100144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MDYSASLWMD NSSPNWTRHE DKMFEVGLVR YGEERIDRWV KIAELLPLKT ARDVEQHYQI  60
LLADVADIDA GLIEVPNYLD NPVLSDEKKG KEPRKQAHQW TAEEHKRFLE GLNRYGKGDW  120
KSIARQCVKT RSATQVASHA QKYFIHLEKD AKNRTKKRSS IYDVSLDD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019183150.11e-113PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A484MT954e-75A0A484MT95_9ASTE; Uncharacterized protein
STRINGXP_004141984.13e-46(Cucumis sativus)
STRINGXP_004160951.13e-46(Cucumis sativus)
STRINGXP_009795456.19e-47(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-44MYB family protein