PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000086.1_g00043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 462aa    MW: 51567.8 Da    PI: 6.1069
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000086.1_g00043.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.92e-138474591374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                              l++lLl+cA +v+ g+le+ + +L ++s+la+pdgd+mqR+a yf++ALa r++r+ +++y+al++++ +  + ++e+ a+k+f+e
  Itr_sc000086.1_g00043.1  47 LIHLLLTCAGHVAGGSLENSNVALDQISHLAAPDGDTMQRIACYFAQALADRVLRTLPGVYRALHSTKLA--SPADEFLARKVFVE 130
                              689*************************************************************998887..599999******** PP

                     GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                              ++P+ k+++l+aNqaI ea+ege++vHiiDf +  ++QW aLlq L++Rpegpp+lRiTgv++     ke +e++g+ L++ Ae+l
  Itr_sc000086.1_g00043.1 131 MFPFSKVAFLVANQAIIEAMEGEKMVHIIDFHAADPTQWRALLQDLSARPEGPPHLRITGVHP----VKEVMEQMGRVLSEEAEKL 212
                              ***************************************************************....9****************** PP

                     GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll............................................ 214
                              ++pf+fn+ +++++e+l+le+Lrvk+gEala+++ +qlh+ll                                            
  Itr_sc000086.1_g00043.1 213 DIPFQFNA-IVSKFESLDLEKLRVKTGEALAISSPMQLHTLLaydddkkpspfaskipnrriqitqnslgdfiehdvgngyspstd 297
                              ********.7999************************************************************************9 PP

                     GRAS 215 ..desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                                ++s+s + +++++L+++++lsPk++vv+eq+++hn+++ +er++e+l++y+alfd+le++lpr s er kvE++llg+ei+n++
  Itr_sc000086.1_g00043.1 298 saSSSLSNSPKIEAFLSALWGLSPKLMVVTEQDSNHNGQTIMERLSESLYFYAALFDCLESTLPRSSIERLKVEKALLGEEIKNII 383
                              876666666699************************************************************************** PP

                     GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              aceg+er+erhe+lekW +r+e+aGF++vp+s++a+ qa++ l+ ++ dgyr++ee+g++v +W+drpL+svSaWr
  Itr_sc000086.1_g00043.1 384 ACEGSERKERHEKLEKWFQRFESAGFGNVPFSYYAMLQARRFLQSFGCDGYRIKEENGCVVTCWQDRPLFSVSAWR 459
                              ***************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.91621439IPR005202Transcription factor GRAS
PfamPF035147.0E-13647459IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MFQDEGSSSS ITSSSPLQAL PVGVSVSPGS PYPWLKELKS EERGLYLIHL LLTCAGHVAG  60
GSLENSNVAL DQISHLAAPD GDTMQRIACY FAQALADRVL RTLPGVYRAL HSTKLASPAD  120
EFLARKVFVE MFPFSKVAFL VANQAIIEAM EGEKMVHIID FHAADPTQWR ALLQDLSARP  180
EGPPHLRITG VHPVKEVMEQ MGRVLSEEAE KLDIPFQFNA IVSKFESLDL EKLRVKTGEA  240
LAISSPMQLH TLLAYDDDKK PSPFASKIPN RRIQITQNSL GDFIEHDVGN GYSPSTDSAS  300
SSLSNSPKIE AFLSALWGLS PKLMVVTEQD SNHNGQTIME RLSESLYFYA ALFDCLESTL  360
PRSSIERLKV EKALLGEEIK NIIACEGSER KERHEKLEKW FQRFESAGFG NVPFSYYAML  420
QARRFLQSFG CDGYRIKEEN GCVVTCWQDR PLFSVSAWRC RR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-65314612380Protein SCARECROW
5b3h_D2e-65314612380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019155689.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7JDZ10.0A0A3Q7JDZ1_SOLLC; Uncharacterized protein
TrEMBLM1A0990.0M1A099_SOLTU; Uncharacterized protein
STRINGSolyc12g099900.1.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]