PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000071.1_g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 515aa    MW: 56674.9 Da    PI: 4.9935
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000071.1_g00050.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS317.92.1e-971555143374
                     GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                              + L++ Ae +++g+  l q++Larl+++ sp+g+p++R+a+yf+eAL++ l +    +  ++p+s+ s    + ++ a+k fsevs
  Itr_sc000071.1_g00050.1 155 DHLFKTAELIQAGNSVLSQEILARLNHHLSPTGKPFHRAAFYFKEALQSLLPH---ATKPTVPSSPFS--LLVFKIGAYKSFSEVS 235
                              789************************************************99...444445666665..699************* PP

                     GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesg.skeeleetgerLakfAee 171
                              P+++f+++t+Nqa+lea+eg +r+Hi+Dfdi++G QW++L+q+La ++   ++psl+iT+++sp ++ ++ el  ++++L +fA+e
  Itr_sc000071.1_g00050.1 236 PMPQFANFTTNQALLEALEGFNRIHIVDFDIGYGEQWASLMQELALKNssTPTPSLKITALASPLKQqDQLELGIIRDNLIQFASE 321
                              *********************************************999667788*********9988899**************** PP

                     GRAS 172 lgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                              +++ fef++l    ++ l+ ++ + +  + a+aVnl +   +   ++vsl+     vL++vk+l+Pk+vv ve+ +d+++ +F ++
  Itr_sc000071.1_g00050.1 322 INMGFEFETL---GVDHLNSSSWSDSDsEAAIAVNLPVGWLSRN-QQVSLPL----VLSFVKQLQPKIVVSVERGCDRTDLPFPDH 399
                              *********9...556666666644442778*******888885.7777777....****************************** PP

                     GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                              ++++l+ +s l++sl+a    + ++ +k+Er+l+++ i++ v+++ ++   ++++ ++Wr  + ++GF+p ++s++a++qa+ +l+
  Itr_sc000071.1_g00050.1 400 IIHTLHSCSNLLESLDAV-NMNPDALQKIERFLIQPGIEKTVSARFDS--PEKTQTQHWRTVFLSSGFTPFSFSNFAESQAEGVLK 482
                              ***************766.45669999****************99988..6666789***************************** PP

                     GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              ++++ g++ve+++ slvl+W++++L+s+SaWr
  Itr_sc000071.1_g00050.1 483 RTPVGGFHVEKRQSSLVLCWQRKELISASAWR 514
                              *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.255127494IPR005202Transcription factor GRAS
PfamPF035147.2E-95155514IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGGAESELLQ PVPVLLEISG GASAVAPEEQ EQEPLLRWIT GDADDPSMAN LSKLLQGGDQ  60
AEYEFNAGLG LQDHNFGADP DSSSSGSAFL PTSSSPANLQ TPSFLSFLDS SDMKPQHLQS  120
PSFFMPLPYY QSQDQSIQPA KRHNPGTLGV PETIDHLFKT AELIQAGNSV LSQEILARLN  180
HHLSPTGKPF HRAAFYFKEA LQSLLPHATK PTVPSSPFSL LVFKIGAYKS FSEVSPMPQF  240
ANFTTNQALL EALEGFNRIH IVDFDIGYGE QWASLMQELA LKNSSTPTPS LKITALASPL  300
KQQDQLELGI IRDNLIQFAS EINMGFEFET LGVDHLNSSS WSDSDSEAAI AVNLPVGWLS  360
RNQQVSLPLV LSFVKQLQPK IVVSVERGCD RTDLPFPDHI IHTLHSCSNL LESLDAVNMN  420
PDALQKIERF LIQPGIEKTV SARFDSPEKT QTQHWRTVFL SSGFTPFSFS NFAESQAEGV  480
LKRTPVGGFH VEKRQSSLVL CWQRKELISA SAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3317151421375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019159323.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813161e-141SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A3Q7EKZ50.0A0A3Q7EKZ5_SOLLC; Uncharacterized protein
STRINGMigut.B01597.1.p1e-170(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-136GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]