PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000052.1_g00043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 572aa    MW: 62414.6 Da    PI: 5.1688
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000052.1_g00043.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS460.31.2e-1402025651374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                              lv++L++cAeav++++++la+al++++  la +++ +m+++a+yf+eALa+r+++        + p++t e++ +++l++   f+e
  Itr_sc000052.1_g00043.1 202 LVHALMACAEAVQQENFKLADALVKHIGILAVSQAGAMRKVATYFAEALARRIYK--------IYPQDTLESSYTDVLQM--HFYE 277
                              689***************************************************9........44666655555555544..4*** PP

                     GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                              ++P+lkf+h+taNqaIlea++ ++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+e+g++La++Ae++
  Itr_sc000052.1_g00043.1 278 TCPYLKFAHFTANQAILEAFNDCSRVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNSDALQEVGWKLAQLAETI 363
                              ************************************************************************************** PP

                     GRAS 173 gvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                              gv+fef+ +va++l+dl+ + L+++p   Ea+aVn+v++lhrll++++ +e+    vL+ +ks++Pk+v++veqea+hn+  Fl+r
  Itr_sc000052.1_g00043.1 364 GVEFEFRGFVANSLADLDASILDIRPshVEAVAVNSVFELHRLLSRTGGIEK----VLNSIKSMKPKIVTIVEQEANHNGVVFLDR 445
                              **************************999***************99999999....****************************** PP

                     GRAS 257 flealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                              f eal+yys++fdsl +++l + ++++ ++++ +lgr+i+nvvaceg +r+erhetl++Wr+r+++aGF pv+l+++a+kqa++ll
  Itr_sc000052.1_g00043.1 446 FNEALHYYSTMFDSLeSSGLTQPNSQDLVMSELYLGRQICNVVACEGPDRIERHETLSQWRARMKSAGFDPVHLGSNAYKQASMLL 531
                              ***************88889999*************************************************************** PP

                     GRAS 342 rkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              + ++ +dgy vee++g+l+lgW++r+L+++SaW+
  Itr_sc000052.1_g00043.1 532 ALFAgGDGYAVEENDGCLMLGWHTRSLIATSAWQ 565
                              *********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.0E-3131101IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011293.2E-2931108No hitNo description
PROSITE profilePS5098568.615176544IPR005202Transcription factor GRAS
PfamPF035144.1E-138202565IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MKRERDRPKA GSSSIGKAKI WEDQPPDAGM DELLAMLGYK VKTSDMADVA EKLEQLEMAM  60
TMTMGTTKED GISHLSTSTV HYNPSDLTGW IQSMLSELHT SDALSQSSVG DEMMLTGESS  120
NIISFSGNKN IGNGNRRISD DDLRAIPGGA IFGNKGKDSS SEPSYKRQKS SAGSDVSGGE  180
SLAVSETPRS VLVDSQEAGV RLVHALMACA EAVQQENFKL ADALVKHIGI LAVSQAGAMR  240
KVATYFAEAL ARRIYKIYPQ DTLESSYTDV LQMHFYETCP YLKFAHFTAN QAILEAFNDC  300
SRVHVIDFSL KQGMQWPALM QALALRPGGP PAFRLTGIGP PQPDNSDALQ EVGWKLAQLA  360
ETIGVEFEFR GFVANSLADL DASILDIRPS HVEAVAVNSV FELHRLLSRT GGIEKVLNSI  420
KSMKPKIVTI VEQEANHNGV VFLDRFNEAL HYYSTMFDSL ESSGLTQPNS QDLVMSELYL  480
GRQICNVVAC EGPDRIERHE TLSQWRARMK SAGFDPVHLG SNAYKQASML LALFAGGDGY  540
AVEENDGCLM LGWHTRSLIA TSAWQLNGGG DP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-711885642378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019185417.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A484MHX50.0A0A484MHX5_9ASTE; Uncharacterized protein
STRINGXP_009796771.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]