PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_79487.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 18962.2 Da PI: 7.5611 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 139.2 | 1.1e-43 | 39 | 129 | 4 | 94 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 q+ +lPianv+rimk vlP ak+sk+ake++qec++efi+fvt+eas++c+re+rkt+ngdd+++a+ tlG+++y+ +++ yl++yre e MLOC_79487.1 39 QEGLLPIANVGRIMKDVLPPAAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVNGDDICHAMKTLGLDNYAGAMRRYLQRYREGE 129 7889************************************************************************************977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-40 | 37 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.58E-32 | 39 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-23 | 43 | 106 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.9E-14 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 5.9E-14 | 89 | 107 | No hit | No description |
PRINTS | PR00615 | 5.9E-14 | 108 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MTNREDFIHF SGFTQQPGRL SLPRAPSTSG SSSGDPNGQE GLLPIANVGR IMKDVLPPAA 60 KVSKHAKEVI QECATEFIGF VTGEASERCR RERRKTVNGD DICHAMKTLG LDNYAGAMRR 120 YLQRYREGEE LTAALNNHSR SPVPPPPDDG MIQIDIWGER SNSRGNEKHG SD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-36 | 39 | 127 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-36 | 39 | 127 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_79487.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078743 | 0.0 | KM078743.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A13) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020196190.1 | 1e-119 | transcriptional activator hap3-like | ||||
Swissprot | O82248 | 4e-41 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M0Z997 | 1e-126 | M0Z997_HORVV; Uncharacterized protein | ||||
STRING | MLOC_79487.1 | 1e-127 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-43 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|