PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_79329.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 149aa MW: 16965.4 Da PI: 12.095 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.5 | 1.8e-14 | 79 | 123 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++ + k++G+g+W+ I+r + +Rt+ q+ s+ qky MLOC_79329.2 79 PWTEDEHRLFLLGLKKYGKGDWRNISRNFVRTRTPTQVASHAQKY 123 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.1280.50 | 2.6E-4 | 1 | 25 | No hit | No description |
PROSITE profile | PS51294 | 16.963 | 71 | 128 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.87E-17 | 74 | 127 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.9E-12 | 76 | 126 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.29E-11 | 79 | 124 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-11 | 79 | 122 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.8E-12 | 79 | 123 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.9E-16 | 79 | 126 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0005515 | Molecular Function | protein binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
VSRGWRVLAQ DERLWEAACV REWAGLGFSE HLLRAVVLLL GGFRRAHAVS INARRRFGGD 60 CGNWHGVRAP GQGRRRPAPW TEDEHRLFLL GLKKYGKGDW RNISRNFVRT RTPTQVASHA 120 QKYFIRLSLG ARRPSIHDIT AVHPPSPSQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_79329.2 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KU857036 | 1e-145 | KU857036.1 Triticum aestivum GID2 protein isoform 1 (gid2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020200806.1 | 3e-82 | F-box protein GID2-like | ||||
Swissprot | Q8S9H7 | 5e-31 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A287K318 | 1e-104 | A0A287K318_HORVV; Uncharacterized protein | ||||
STRING | MLOC_79329.2 | 1e-104 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12451 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 1e-22 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|