PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_78504.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 133aa MW: 15265.2 Da PI: 7.5079 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.5 | 5.5e-17 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +++E+ l++++++++G++ W++Iar+++ gRt++++k++w++++ MLOC_78504.5 2 SPQEEHLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43 89****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.521 | 1 | 47 | IPR017930 | Myb domain |
CDD | cd00167 | 1.67E-11 | 1 | 43 | No hit | No description |
SMART | SM00717 | 2.9E-10 | 1 | 45 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-15 | 2 | 42 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-20 | 2 | 44 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.85E-13 | 2 | 48 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MSPQEEHLII ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER KTDMSPSSSS 60 SSFTYQSCLL ETAPIIRMDE SSTHNGTTCF SSVLKSNQSV MDGYSMDQIW KEIEAPAMLP 120 IDDTSCSNLP SPL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_78504.5 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK367218 | 0.0 | AK367218.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2053B03. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156608.1 | 2e-84 | myb-related protein MYBAS1-like | ||||
Swissprot | Q53NK6 | 8e-67 | MYBA1_ORYSJ; Myb-related protein MYBAS1 | ||||
TrEMBL | F2DTK0 | 2e-92 | F2DTK0_HORVV; Predicted protein (Fragment) | ||||
STRING | MLOC_78504.2 | 3e-88 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.1 | 4e-33 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|