PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_75510.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

bZIP

Protein Properties

Length: 206aa MW: 22400.1 Da PI: 6.3611

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_75510.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	35.9	1.7e-11	140	187	5	52
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 kr +r NR +A rs +RK +i+eLe kv++L++e ++L +l +l MLOC_75510.2 140 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTML 187 899***************************************999877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	7.6E-15	136	200	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.082	138	188	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.1E-10	140	187	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	6.88E-13	140	196	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.7E-12	140	194	No hit	No description
CDD	cd14703	1.13E-20	141	188	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005829	Cellular Component	cytosol
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 206 aa Download sequence Send to blast
MDLDGMDALN SSEDHHDDRD SHSRASGTRA TSAAESSENE AESQSTSAER KDGAKSRHCR 60 SLSMDSFMGK LNYATCDDSP KLPLPSPSGG LSRSGSGSLD GGGAASLFGT EFANGEFTEA 120 EKKKIMANER LAEIALTDPK RVKRILANRQ SAARSKERKM RYIQELEHKV QVLQTEATTL 180 SAQLTMLQVC LVELLCILSF LMLGRN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269\|PubMed:11432846, ECO:0000269\|PubMed:12124400, ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315, ECO:0000269\|PubMed:17947581, ECO:0000269\|PubMed:19820165, ECO:0000269\|PubMed:20547563}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_75510.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269\|PubMed:15108305}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK374525	0.0	AK374525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3068B13.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025822599.1	1e-110	transcription factor RF2a-like
Swissprot	Q9MA75	2e-27	VIP1_ARATH; Transcription factor VIP1
TrEMBL	A0A287WL73	1e-147	A0A287WL73_HORVV; Uncharacterized protein
STRING	MLOC_75510.1	1e-134	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	9e-43	bZIP family protein

Publications ? help Back to Top
Wang Y, et al. The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus. New Phytol., 2014. 203(4): p. 1266-81 [PMID:24865527] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Chen J, et al. ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters. J. Exp. Bot., 2016. 67(5): p. 1327-38 [PMID:26689855] Tsugama D,Liu S,Takano T VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis. Plant Signal Behav, 2016. 11(6): p. e1187358 [PMID:27171129] Tsugama D,Liu S,Takano T The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots. Plant Physiol., 2016. 171(2): p. 1355-65 [PMID:27208231] Takeo K,Ito T Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins. FEBS Lett., 2017. 591(13): p. 1972-1981 [PMID:28542772] Wang L,Lacroix B,Guo J,Citovsky V The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family. Mol. Plant Pathol., 2018. 19(5): p. 1172-1183 [PMID:28802023]