PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_73122.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 140aa MW: 16169.7 Da PI: 9.5232 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.1 | 2.7e-15 | 38 | 82 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky MLOC_73122.4 38 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 82 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 6.1E-11 | 35 | 85 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.73E-17 | 36 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.436 | 37 | 87 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 2.2E-18 | 37 | 86 | IPR006447 | Myb domain, plants |
CDD | cd00167 | 2.19E-11 | 38 | 83 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.5E-13 | 38 | 81 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.3E-13 | 38 | 82 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MQREIYMRIF FFHLQLFDAY IICCHSVNSI YCNYAAVPWT EEEHRTFLAG LEKLGKGDWR 60 GIAKNFVTTR TPTQVASHAQ KYFLRQTNPN KKKRRSSLFD MMASDLSPAP NCPILPPTMA 120 KFHDMVTMTN QLQNSSLVSS |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 90 | 94 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_73122.4 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK366649 | 1e-172 | AK366649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2045F05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020193360.1 | 3e-70 | uncharacterized protein LOC109779160 isoform X1 | ||||
Refseq | XP_020193361.1 | 3e-71 | transcription factor SRM1-like isoform X2 | ||||
Swissprot | B8BI93 | 1e-36 | MYBS2_ORYSI; Transcription factor MYBS2 | ||||
Swissprot | Q7XC51 | 1e-36 | MYBS2_ORYSJ; Transcription factor MYBS2 | ||||
TrEMBL | M0YUH7 | 1e-100 | M0YUH7_HORVV; Uncharacterized protein | ||||
STRING | MLOC_73122.2 | 1e-101 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 3e-36 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|