PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_71418.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 141aa MW: 15872.2 Da PI: 11.9803 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55 | 1.9e-17 | 43 | 90 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT++Ed +l+ +++++G +W++ +r g+ R++k+c++rw +yl MLOC_71418.3 43 RGSWTPQEDMRLIAYIQKHGHANWRALPRQAGLLRCGKSCRLRWINYL 90 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.5E-23 | 34 | 93 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.402 | 38 | 94 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-12 | 42 | 92 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-15 | 43 | 90 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.72E-21 | 44 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.98E-10 | 45 | 90 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-7 | 94 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MLPTASWTRP NRARTSEQTA EWSRAADMGR GRAPCCAKVG LNRGSWTPQE DMRLIAYIQK 60 HGHANWRALP RQAGLLRCGK SCRLRWINYL RPDLRRGNFT ADEEATVIKL HGLLGNKCGP 120 RSRRACPGGR TTRSRTSGTR T |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-14 | 41 | 117 | 25 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_71418.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK111933 | 1e-118 | AK111933.1 Oryza sativa Japonica Group cDNA clone:001-017-B10, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020189024.1 | 1e-58 | myb-related protein Zm1-like | ||||
Swissprot | P20024 | 4e-56 | MYB1_MAIZE; Myb-related protein Zm1 | ||||
TrEMBL | A0A287UI13 | 1e-77 | A0A287UI13_HORVV; Uncharacterized protein | ||||
STRING | MLOC_71418.2 | 1e-79 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79180.1 | 7e-49 | myb domain protein 63 |
Publications ? help Back to Top | |||
---|---|---|---|
|