PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_71128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 139aa    MW: 16517.9 Da    PI: 9.647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_71128.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM187.23.6e-5861331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhPtdeel+ +yLk k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s 
  MLOC_71128.1   6 LPPGFRFHPTDEELIIYYLKSKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS- 100
                   79****************************.99**************95334455777**************************************. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++++vg+kktLv+y+grap+g++tdWvmheyrl
  MLOC_71128.1 101 QKRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                   9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-614137IPR003441NAC domain
PROSITE profilePS5100557.0646139IPR003441NAC domain
PfamPF023657.1E-317133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKSKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QKRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-55213311140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_71128.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190976.19e-97uncharacterized protein LOC109776722
RefseqXP_025879980.14e-98NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI52e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A287PZ911e-100A0A287PZ91_HORVV; Uncharacterized protein
TrEMBLA0A453J6S81e-100A0A453J6S8_AEGTS; Uncharacterized protein
STRINGEMT236146e-97(Aegilops tauschii)
STRINGMLOC_71128.11e-100(Hordeum vulgare)
STRINGTraes_4BL_D592DBAAF.13e-96(Triticum aestivum)
STRINGTraes_4DL_A13AE4BE6.24e-96(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-91NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]