PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_71128.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 139aa MW: 16517.9 Da PI: 9.647 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 187.2 | 3.6e-58 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+ +yLk k++g+++el e+i+evd+yk+ePwdLp k + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s MLOC_71128.1 6 LPPGFRFHPTDEELIIYYLKSKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS- 100 79****************************.99**************95334455777**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg+kktLv+y+grap+g++tdWvmheyrl MLOC_71128.1 101 QKRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133 9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-61 | 4 | 137 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.064 | 6 | 139 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.1E-31 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MAPVSLPPGF RFHPTDEELI IYYLKSKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK 60 DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QKRAVGMKKT LVYYRGRAPH 120 GSRTDWVMHE YRLDERECE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-55 | 2 | 133 | 11 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00212 | DAP | Transfer from AT1G65910 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_71128.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190976.1 | 9e-97 | uncharacterized protein LOC109776722 | ||||
Refseq | XP_025879980.1 | 4e-98 | NAC domain-containing protein 86 isoform X2 | ||||
Swissprot | Q9FFI5 | 2e-85 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A287PZ91 | 1e-100 | A0A287PZ91_HORVV; Uncharacterized protein | ||||
TrEMBL | A0A453J6S8 | 1e-100 | A0A453J6S8_AEGTS; Uncharacterized protein | ||||
STRING | EMT23614 | 6e-97 | (Aegilops tauschii) | ||||
STRING | MLOC_71128.1 | 1e-100 | (Hordeum vulgare) | ||||
STRING | Traes_4BL_D592DBAAF.1 | 3e-96 | (Triticum aestivum) | ||||
STRING | Traes_4DL_A13AE4BE6.2 | 4e-96 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 3e-91 | NAC domain containing protein 28 |
Publications ? help Back to Top | |||
---|---|---|---|
|