PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_70567.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

HSF

Protein Properties

Length: 122aa MW: 13377.1 Da PI: 6.3808

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_70567.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	80.5	2.6e-25	41	103	2	64
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 Fl+k+y++++d+ +++++sw e+ +fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y ++ MLOC_70567.2 41 FLTKTYQLVDDPCTDHIVSWGEDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVCHS 103 9**********************************************************7665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.9E-27	35	103	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	3.6E-25	37	121	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.58E-23	38	112	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	6.4E-16	41	64	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	1.7E-21	41	103	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.4E-16	79	91	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.4E-16	92	104	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042802	Molecular Function	identical protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MAFLVERCGE MVVSMEMGSG AHGGGGGGGG GGVGKPVPAP FLTKTYQLVD DPCTDHIVSW 60 GEDDATFVVW RPPEFARDLL PNYFKHNNFS SFVRQLNTYV CHSSYSLSPA PYTTHERMHP 120 HM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-16	17	99	3	87	Heat shock factor protein 1
5d5v_B	1e-16	17	99	3	87	Heat shock factor protein 1
5d5v_D	1e-16	17	99	3	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_70567.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK376881	1e-166	AK376881.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3143C10.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006658884.1	8e-55	PREDICTED: heat stress transcription factor B-4b-like
Swissprot	Q7XHZ0	2e-52	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	F2EL53	5e-67	F2EL53_HORVV; Predicted protein
STRING	MLOC_70567.1	4e-68	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	1e-40	heat shock transcription factor B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]