PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_69621.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 183aa MW: 20644.3 Da PI: 5.8808 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 160.8 | 5.2e-50 | 45 | 170 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++++ MLOC_69621.1 45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSR 140 79***************************.89***************7777899******************************************* PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +glkktLvfy+g+apkg++++W+m+eyrl MLOC_69621.1 141 PIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170 ****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-54 | 44 | 176 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.609 | 44 | 183 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-25 | 46 | 170 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF 60 YLRRKVEGRR FNVELITFLD LYRFDPWELP AMAVIGEKEW FFYVPRDRKY RNGDRPNRVT 120 ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPTTDADLF 180 YKI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-54 | 46 | 174 | 19 | 146 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-54 | 46 | 174 | 19 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-54 | 46 | 174 | 19 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-54 | 46 | 174 | 19 | 146 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swm_B | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swm_C | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swm_D | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swp_A | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swp_B | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swp_C | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
3swp_D | 3e-54 | 46 | 174 | 22 | 149 | NAC domain-containing protein 19 |
4dul_A | 2e-54 | 46 | 174 | 19 | 146 | NAC domain-containing protein 19 |
4dul_B | 2e-54 | 46 | 174 | 19 | 146 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_69621.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR819762 | 1e-165 | FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014753810.1 | 1e-112 | NAC domain-containing protein 22 isoform X1 | ||||
Swissprot | Q9ZVP8 | 6e-87 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A287FYY5 | 1e-130 | A0A287FYY5_HORVV; Uncharacterized protein | ||||
TrEMBL | M0YID1 | 1e-130 | M0YID1_HORVV; Uncharacterized protein | ||||
STRING | MLOC_69621.2 | 1e-131 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 2e-88 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|