PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_69621.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

NAC

Protein Properties

Length: 183aa MW: 20644.3 Da PI: 5.8808

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_69621.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	160.8	5.2e-50	45	170	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++++ MLOC_69621.1 45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSR 140 79*************************.89***********7777899*************************************** PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +glkktLvfy+g+apkg++++W+m+eyrl MLOC_69621.1 141 PIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.75E-54	44	176	IPR003441	NAC domain
PROSITE profile	PS51005	51.609	44	183	IPR003441	NAC domain
Pfam	PF02365	2.3E-25	46	170	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF 60 YLRRKVEGRR FNVELITFLD LYRFDPWELP AMAVIGEKEW FFYVPRDRKY RNGDRPNRVT 120 ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPTTDADLF 180 YKI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-54	46	174	19	146	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-54	46	174	19	146	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-54	46	174	19	146	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-54	46	174	19	146	NO APICAL MERISTEM PROTEIN
3swm_A	3e-54	46	174	22	149	NAC domain-containing protein 19
3swm_B	3e-54	46	174	22	149	NAC domain-containing protein 19
3swm_C	3e-54	46	174	22	149	NAC domain-containing protein 19
3swm_D	3e-54	46	174	22	149	NAC domain-containing protein 19
3swp_A	3e-54	46	174	22	149	NAC domain-containing protein 19
3swp_B	3e-54	46	174	22	149	NAC domain-containing protein 19
3swp_C	3e-54	46	174	22	149	NAC domain-containing protein 19
3swp_D	3e-54	46	174	22	149	NAC domain-containing protein 19
4dul_A	2e-54	46	174	19	146	NAC domain-containing protein 19
4dul_B	2e-54	46	174	19	146	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_69621.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FR819762	1e-165	FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014753810.1	1e-112	NAC domain-containing protein 22 isoform X1
Swissprot	Q9ZVP8	6e-87	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A287FYY5	1e-130	A0A287FYY5_HORVV; Uncharacterized protein
TrEMBL	M0YID1	1e-130	M0YID1_HORVV; Uncharacterized protein
STRING	MLOC_69621.2	1e-131	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	2e-88	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]