PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_65456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 356aa    MW: 39014.9 Da    PI: 8.2048
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_65456.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.42e-47171433128
           NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                   pGfrFhPt+eel+ +yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+  g r++r+t++g+Wkatg+d+++ s+   +
  MLOC_65456.1  17 PGFRFHPTEEELLGFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGCGGRPSRTTERGFWKATGSDRAIRSTadPK 112
                   9*************************99.99***************888999***************************************987777 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +++g+kktLvfykgrap+g+ktdWvm+eyrl
  MLOC_65456.1 113 RVIGIKKTLVFYKGRAPRGTKTDWVMNEYRL 143
                   88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-5712163IPR003441NAC domain
PROSITE profilePS5100554.27315163IPR003441NAC domain
PfamPF023655.6E-2417143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MAMAAAASTI EVEHDLPGFR FHPTEEELLG FYLSRVALGK KLHFDIIGTL NIYRHDPWDL  60
PGMAKIGERE WYFFVPRDRK AGCGGRPSRT TERGFWKATG SDRAIRSTAD PKRVIGIKKT  120
LVFYKGRAPR GTKTDWVMNE YRLPDTGAAP PKEDTVLCKV YRKATPLKEL EQRAYEMEEV  180
KQRSGGNGGY GYGGAARACP VPTSDTSAVD DYFPSSDDVQ DNFMTPSFSS SSSVAPSGNS  240
SSHDAPRVAK KEADLGRVTV PSTSSVPQSA NTPLRLQLPA VNPPCGLQLP AANHGMSNLS  300
SLPAASHGVL DLPSQQLPAA GNQGVFDWLQ DPFLTQLRSP WQDQHCVSPY AHLLYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-461716519167NO APICAL MERISTEM PROTEIN
1ut4_B2e-461716519167NO APICAL MERISTEM PROTEIN
1ut7_A2e-461716519167NO APICAL MERISTEM PROTEIN
1ut7_B2e-461716519167NO APICAL MERISTEM PROTEIN
3swm_A2e-461716522170NAC domain-containing protein 19
3swm_B2e-461716522170NAC domain-containing protein 19
3swm_C2e-461716522170NAC domain-containing protein 19
3swm_D2e-461716522170NAC domain-containing protein 19
3swp_A2e-461716522170NAC domain-containing protein 19
3swp_B2e-461716522170NAC domain-containing protein 19
3swp_C2e-461716522170NAC domain-containing protein 19
3swp_D2e-461716522170NAC domain-containing protein 19
3ulx_A2e-461116510170Stress-induced transcription factor NAC1
4dul_A2e-461716519167NAC domain-containing protein 19
4dul_B2e-461716519167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_65456.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190294.10.0NAC domain-containing protein 72-like
SwissprotQ10S651e-143NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLM0Y3U10.0M0Y3U1_HORVV; Uncharacterized protein
STRINGMLOC_65456.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-86NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]