PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_64963.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 214aa MW: 23204.5 Da PI: 6.6704 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.6 | 6e-18 | 8 | 53 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEd l ++v+++G ++W++I r ++ gR++k+c++rw + MLOC_64963.1 8 RGPWSPEEDGALRQLVELHGARNWTAIGRGVP-GRSGKSCRLRWCNQ 53 89******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 49.5 | 9.6e-16 | 60 | 102 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r ++T++Ed +++a+++lG++ W++Iar + gRt++ +k++w+ MLOC_64963.1 60 RRPFTADEDAVIARAHARLGNR-WAAIARLLR-GRTDNAVKNHWN 102 679*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.363 | 1 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.02E-29 | 5 | 101 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.9E-15 | 7 | 56 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.3E-17 | 8 | 53 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-23 | 9 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.64E-14 | 10 | 52 | No hit | No description |
SMART | SM00717 | 2.9E-13 | 59 | 107 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-13 | 60 | 102 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.996 | 60 | 109 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.4E-21 | 61 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.25E-10 | 62 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MEGCDRIRGP WSPEEDGALR QLVELHGARN WTAIGRGVPG RSGKSCRLRW CNQLSPGVER 60 RPFTADEDAV IARAHARLGN RWAAIARLLR GRTDNAVKNH WNCSLKRRIG AVDAAGDGEE 120 ERPCKRASVT PESTSGSGSG SGSDRSDLSH GDVFGLVQVY RPVARAGGLE PADCAMSQGH 180 EEDEEQEDTF TSLSLSLPGT DAHGFHHDSS HSHF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-36 | 5 | 109 | 4 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_64963.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020162234.1 | 1e-118 | transcription factor MYB44-like | ||||
Swissprot | Q9FDW1 | 1e-65 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A287XXN0 | 1e-154 | A0A287XXN0_HORVV; Uncharacterized protein | ||||
STRING | MLOC_64963.1 | 1e-155 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP789 | 38 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 3e-61 | myb domain protein r1 |