PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_63743.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 163aa    MW: 18248.9 Da    PI: 10.2942
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_63743.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.6e-51191431128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeelv++yL+++++g ++++  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg dk+v s   
  MLOC_63743.3  19 LPPGFRFHPTDEELVMHYLCRRCAGLPISV-PIIAEVDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRSAGTGYWKATGADKPVGS--P 112
                   79****************************.88***************7666789*************************************99..7 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +   +kk Lvfy g+apkg kt+W+mheyrl
  MLOC_63743.3 113 KPLAIKKALVFYAGKAPKGDKTNWIMHEYRL 143
                   789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-5715146IPR003441NAC domain
PROSITE profilePS5100554.41719163IPR003441NAC domain
PfamPF023652.2E-2620143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSGGGGGSAA TQGQQDLQLP PGFRFHPTDE ELVMHYLCRR CAGLPISVPI IAEVDLYKFD  60
PWQLPRMALY GEKEWYFFSP RDRKYPNGSR PNRSAGTGYW KATGADKPVG SPKPLAIKKA  120
LVFYAGKAPK GDKTNWIMHE YRLADVDRSA RKKNSLRAAF SRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-7061432140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_63743.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3658120.0AK365812.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2037P06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020166636.11e-112NAC domain-containing protein 48-like
SwissprotQ7F2L31e-101NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM0XWR21e-118M0XWR2_HORVV; Uncharacterized protein
STRINGMLOC_63743.11e-112(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-92NAC family protein
Publications ? help Back to Top
  1. Xiong L,Lee MW,Qi M,Yang Y
    Identification of defense-related rice genes by suppression subtractive hybridization and differential screening.
    Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92
    [PMID:11332734]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Ohnishi T, et al.
    OsNAC6, a member of the NAC gene family, is induced by various stresses in rice.
    Genes Genet. Syst., 2005. 80(2): p. 135-9
    [PMID:16172526]
  4. Hu H, et al.
    Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.
    Plant Mol. Biol., 2008. 67(1-2): p. 169-81
    [PMID:18273684]
  5. Kim MJ, et al.
    Quadruple 9-mer-based protein binding microarray with DsRed fusion protein.
    BMC Mol. Biol., 2009. 10: p. 91
    [PMID:19761621]
  6. Chung PJ,Kim JK
    Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth.
    Plant Signal Behav, 2009. 4(7): p. 675-7
    [PMID:19820307]
  7. Peng HF, et al.
    Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.).
    Theor. Appl. Genet., 2010. 120(5): p. 1013-20
    [PMID:20012261]
  8. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  9. Kim MJ, et al.
    Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein.
    Methods Mol. Biol., 2012. 786: p. 65-77
    [PMID:21938620]
  10. Gupta SK, et al.
    The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice.
    J. Exp. Bot., 2012. 63(2): p. 757-72
    [PMID:22058403]
  11. Nakashima K, et al.
    Comparative functional analysis of six drought-responsive promoters in transgenic rice.
    Planta, 2014. 239(1): p. 47-60
    [PMID:24062085]
  12. Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice.
    Rice (N Y), 2012. 5(1): p. 6
    [PMID:24764506]
  13. Qian B, et al.
    Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+).
    J. Plant Physiol., 2015. 175: p. 9-20
    [PMID:25460871]
  14. Shiriga K, et al.
    Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize.
    Meta Gene, 2014. 2: p. 407-17
    [PMID:25606426]
  15. Farooq MA,Detterbeck A,Clemens S,Dietz KJ
    Silicon-induced reversibility of cadmium toxicity in rice.
    J. Exp. Bot., 2016. 67(11): p. 3573-85
    [PMID:27122572]
  16. Lee DK, et al.
    The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.
    Plant Biotechnol. J., 2017. 15(6): p. 754-764
    [PMID:27892643]