PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_61901.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 183aa MW: 21386.7 Da PI: 9.6662 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.8 | 1.2e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gklyey++ MLOC_61901.3 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSPKGKLYEYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 111.6 | 8.1e-37 | 77 | 172 | 3 | 98 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ s+e++ + ++++e++kLk++ie++q+ ++hl+GedL+sL+lkeLqqLeqqLe+slk+iRs+K++l++e+i+elqkke++lqeenkaL+k++ MLOC_61901.3 77 EKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLDSLNLKELQQLEQQLESSLKHIRSRKSHLMMESISELQKKERSLQEENKALQKEV 172 5556667888899********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.5E-43 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.095 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.24E-35 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.22E-41 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 3.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.5E-31 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.311 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAVIVFSP KGKLYEYATD 60 SSMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK HLMGEDLDSL 120 NLKELQQLEQ QLESSLKHIR SRKSHLMMES ISELQKKERS LQEENKALQK EVIKLLNKEP 180 IVT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 1e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_61901.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ249146 | 0.0 | AJ249146.1 Hordeum vulgare mRNA for MADS-box protein 8 (m8 gene). | |||
GenBank | AK249833 | 0.0 | AK249833.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf58g24, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020149442.1 | 1e-122 | MADS-box transcription factor 15-like | ||||
Swissprot | Q6Q9I2 | 1e-106 | MAD15_ORYSJ; MADS-box transcription factor 15 | ||||
TrEMBL | A0A446L076 | 1e-127 | A0A446L076_TRITD; Uncharacterized protein | ||||
STRING | MLOC_61901.1 | 1e-121 | (Hordeum vulgare) | ||||
STRING | Traes_2AL_20C2D79E1.2 | 1e-121 | (Triticum aestivum) | ||||
STRING | Traes_2BL_26F24E716.1 | 1e-121 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 2e-74 | MIKC_MADS family protein |