PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_61513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TCP
Protein Properties Length: 85aa    MW: 9056.28 Da    PI: 4.3887
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_61513.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP67.93.4e-212462872
           TCP 28 caarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72
                  +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++
  MLOC_61513.1  2 VAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPQEA 46
                  8*************************************7766633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136919.483136IPR017887Transcription factor TCP subgroup
PfamPF036342.3E-16247IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MVAARVFQLT RELGHRTDGE TIEWLLRQAE PSIIAATGTG VTPQEAPSAA VPVAPFVQVP  60
YYTALLMQPP SANDPPLASA AEENK
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_61513.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727371e-142AK372737.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581062.19e-43transcription factor PCF1
SwissprotO238759e-38PCF1_ORYSJ; Transcription factor PCF1
TrEMBLF2E9B22e-53F2E9B2_HORVV; Predicted protein (Fragment)
STRINGMLOC_61513.17e-55(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.15e-22TCP family protein