PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_60198.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 178aa MW: 19996.4 Da PI: 5.3942 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 100 | 1.6e-31 | 1 | 52 | 4 | 55 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+ MLOC_60198.1 1 MRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 52 79*************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 2.0E-23 | 1 | 52 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.7E-28 | 1 | 54 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.138 | 1 | 55 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.9E-10 | 1 | 51 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.3E-16 | 1 | 52 | IPR009057 | Homeodomain-like |
Pfam | PF14379 | 1.2E-22 | 84 | 129 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MRWTPELHER FVDAVNLLGG SEKATPKGVL KLMKADNLTI YHVKSHLQKY RTARYRPELS 60 EGSSERLEAS KEDLPSIDLK GNFDLTEALR LQLELQKRLH EQLEVQRSLQ LRIEEQGKCL 120 QIMIEQQCNP AADKALDAST SAEGSKLPSD PPESSTVKDV PNNSQNGTTE RAESGDKE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}. | |||||
UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_60198.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK250181 | 0.0 | AK250181.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf70h19, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020191223.1 | 1e-122 | protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1 | ||||
Swissprot | B8B5N8 | 1e-106 | PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
Swissprot | Q6Z156 | 1e-106 | PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
TrEMBL | A0A287KBS8 | 1e-125 | A0A287KBS8_HORVV; Uncharacterized protein | ||||
STRING | MLOC_60198.1 | 1e-128 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1971 | 37 | 89 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28610.1 | 1e-63 | phosphate starvation response 1 |